SAB2108754

Anti-ZNF423

affinity isolated antibody

• Synonym(s): Anti- KIAA0760, Anti- MGC138520, Anti- MGC138522, Anti- OAZ, Anti-Ebfaz
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 144 kDa
• species reactivity: guinea pig, dog, mouse, rat, human, rabbit, bovine, horse
• concentration: 0.5-1 mg/mL
• technique(s): immunoblotting: suitable
• accession no.: NM_015069
• UniProt accession no.: Q2M1K9
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... ZNF423(23090)

Description

Immunogen

Synthetic peptide directed towards the middle region of human ZNF423

Biochem/physiol Actions

ZNF423 is the transcription factor that can both act as an activator or a repressor depending on the context. ZNF423 plays a central role in BMP signaling and olfactory neurogenesis. ZNF423 is associates with SMADs in response to BMP2 leading to activate

Sequence

Synthetic peptide located within the following region: CFTVFVQANKLQQHIFAVHGQEDKIYDCSQCPQKFFFQTELQNHTMSQHA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable