Skip to Content
Merck
All Photos(1)

Key Documents

SAB2108339

Sigma-Aldrich

Anti-SLC46A1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-G21, Anti-HCP1, Anti-PCFT

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
PLN 2,220.00

PLN 2,220.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
PLN 2,220.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

PLN 2,220.00


Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

50kDa

species reactivity

rabbit, horse, human, guinea pig, dog, rat, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

immunoblotting: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

Immunogen

Synthetic peptide directed towards the N terminal region of human SLC46A1

Biochem/physiol Actions

This gene encodes a transmembrane proton-coupled folate transporter protein that facilitates the movement of folate and antifolate substrates across cell membranes optimally in acidic pH environments. This protein is also expressed in the brain and choroi

Sequence

Synthetic peptide located within the following region: MEGSASPPEKPRARPAAAVLCRGPVEPLVFLANFALVLQGPLTTQYLWHR

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Julian C Gilmore et al.
EBioMedicine, 75, 103771-103771 (2021-12-27)
Due to the critical role of folates in neurodevelopment, it is important to understand potential interactions between anti-HIV drugs used during pregnancy, and folate delivery pathways in the placenta. This study investigates the effect of dolutegravir (DTG) exposure on the
Vishal Sangha et al.
Fluids and barriers of the CNS, 21(1), 67-67 (2024-08-28)
Folates are a family of B9 vitamins essential for normal growth and development in the central nervous system (CNS). Transport of folates is mediated by three major transport proteins: folate receptor alpha (FRα), proton-coupled folate transporter (PCFT), and reduced folate
Camille Alam et al.
Molecular pharmaceutics, 14(11), 3848-3858 (2017-09-09)
Folates are essential for brain development and function. Folate transport in mammalian tissues is mediated by three major folate transport systems, i.e., reduced folate carrier (RFC), proton-coupled folate transporter (PCFT), and folate receptor alpha (FRα), known to be regulated by
Vishal Sangha et al.
Fluids and barriers of the CNS, 19(1), 92-92 (2022-11-25)
Folates are a family of B9 vitamins that serve as one-carbon donors critical to biosynthetic processes required for the development and function of the central nervous system (CNS) in mammals. Folate transport is mediated by three highly specific systems: (1)

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service