Skip to Content
Merck
All Photos(5)

Key Documents

HPA015313

Sigma-Aldrich

Anti-NDRG4 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Brain development-related molecule 1, Anti-Protein NDRG4, Anti-SMAP-8, Anti-Vascular smooth muscle cell-associated protein 8

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
PLN 2,680.00

PLN 2,680.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
PLN 2,680.00

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

PLN 2,680.00


Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
recombinant expression
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

RQQIGNVVNQANLQLFWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVVECNSKLDPTTTTFLKMADSGGLP

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... NDRG4(65009)

General description

NDRG4 (N-myc downstream regulated gene 4) is a member of the four protein family called NDRG. This protein, along with NDRG2 makes up a subfamily. This gene is localized to human chromosome 16q21-q22.3, is composed of seventeen exons, and spans 26kb. Alternative splicing gives rise to three isoforms called, NDRG4-B, NDRG4-Bvar, and NDRG4-H. Its expression is restricted to brain and heart.

Immunogen

Protein NDRG4 recombinant protein epitope signature tag (PrEST)

Application

Anti-NDRG4 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

NDRG4 (N-myc downstream regulated gene 4) is believed to act as a tumor suppressor gene, as it is inactivated in multiple cancer types. Studies suggest that this gene is involved in the survival of cell, and invasiveness of tumor cells. Homozygous variant in this gene might be the cause of infantile myofibromatosis (IM), which is characterized by benign tumor development in bone, viscera, skin and muscle. This gene is up-regulated in aggressive meningioma, and is involved in controlling cell proliferation, metastasis and angiogenesis in the same. It is methylated and silenced in colorectal cancer (CRC), and might have potential as a marker to determine CRC in sample stools. It is essential for cell growth and survival in glioblastoma and astrocytes.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72717

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Natália D Linhares et al.
European journal of medical genetics, 57(11-12), 643-648 (2014-09-23)
Infantile myofibromatosis (IM) is a rare disorder characterized by the development of benign tumors in the skin, muscle, bone, and viscera. The incidence is 1/150,000 live births and the disease is the most common cause of fibrous tumors in infancy.
Xinxin Yang et al.
Biomedicine & pharmacotherapy = Biomedecine & pharmacotherapie, 67(7), 681-684 (2013-06-04)
The N-myc downstream-regulated genes, NDRG3 and NDRG4, are suggested to play important roles in biological processes and pathogenesis. Expression of NDRG3 and NDRG4 has been shown to be reduced or absent in numerous cancer cell lines and tumor types, suggesting
Veerle Melotte et al.
Journal of the National Cancer Institute, 101(13), 916-927 (2009-06-19)
Identification of hypermethylated tumor suppressor genes in body fluids is an appealing strategy for the noninvasive detection of colorectal cancer. Here we examined the role of N-Myc downstream-regulated gene 4 (NDRG4) as a novel tumor suppressor and biomarker in colorectal
Rama P Kotipatruni et al.
Integrative biology : quantitative biosciences from nano to macro, 4(10), 1185-1197 (2012-08-08)
Meningiomas are the second most common brain tumor, and 20-30% of these tumors are aggressive. The aggressive subtypes are characterized by a capacity for invasion of normal brain with frequent and destructive recurrence patterns. Effective local therapies include surgery and
Elisa H F Jandrey et al.
NPJ breast cancer, 5, 11-11 (2019-04-10)
The risk of developing metastatic disease in breast cancer patients is traditionally predictable based on the number of positive axillary lymph nodes, complemented with additional clinicopathological factors. However, since lymph node-negative patients have a 20-30% probability of developing metastatic disease

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service