Skip to Content
Merck
All Photos(3)

Key Documents

HPA014657

Sigma-Aldrich

Anti-GMPPB antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-GDP-mannose pyrophosphorylase B, Anti-GTP-mannose-1-phosphate guanylyltransferase beta, Anti-Mannose-1-phosphate guanyltransferase beta

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
PLN 2,680.00

PLN 2,680.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
PLN 2,680.00

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

PLN 2,680.00


Please contact Customer Service for Availability

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50

immunogen sequence

VLEKEMKAQEQRLGIRISMSHEEEPLGTAGPLALARDLLSETADPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGRIHRFVEKPQVFVSNKINAGMYILSPAVLRRIQLQPTSIEKEVFPIMA

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... GMPPB(29925)

General description

GMPPB (guanosine diphosphate mannose (GDP-mannose) pyrophosphorylase B) protein is a part of the glycosylation pathway. It was first identified and partially characterized from Athrobacter sp. and is highly conserved among multiple species. This protein is composed of 360 amino acids, and shows high sequence similarity with porcine GMPPB. This protein resides in the cytoplasm, and has a human paralog called GMPPA. Both these proteins share 30% identity. This gene is localized to human chromosome 3p21.31.

Immunogen

Mannose-1-phosphate guanyltransferase beta recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

GMPPB (guanosine diphosphate mannose (GDP-mannose) pyrophosphorylase B) catalyzes the conversion of mannose-1-phosphate to GDP-mannose, in the presence of GTP. It is responsible for the O-mannosylation of multiple proteins such as, α-dystroglycan (α-DG). Mutations in this gene lead to the aggregation of GMPPB in the cytosol and in proximity to membrane protrusions. It also results in hypoglycosylation of α-DG, leading to congenital and limb-girdle muscular dystrophies. Mutations in this gene are linked to generalized epilepsy, as glycosylation might play an important part in the neuronal channels and network. Mutations in this gene are as linked to isolated episodes of rhabdomyolysis. This gene locus is also linked to musculo-eye-brain disorders.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70273

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Macarena Cabrera-Serrano et al.
Brain : a journal of neurology, 138(Pt 4), 836-844 (2015-02-15)
Dystroglycanopathies are a heterogeneous group of diseases with a broad phenotypic spectrum ranging from severe disorders with congenital muscle weakness, eye and brain structural abnormalities and intellectual delay to adult-onset limb-girdle muscular dystrophies without mental retardation. Most frequently the disease
The 2014 version of the gene table of monogenic neuromuscular disorders (nuclear genome).
Jean-Claude Kaplan et al.
Neuromuscular disorders : NMD, 23(12), 1081-1111 (2014-01-22)
Wo-Tu Tian et al.
Annals of clinical and translational neurology, 6(6), 1062-1071 (2019-06-19)
GDP-mannose pyrophosphorylase B (GMPPB) related phenotype spectrum ranges widely from congenital myasthenic syndrome (CMS), limb-girdle muscular dystrophy type 2T (LGMD 2T) to severe congenital muscle-eye-brain syndrome. Our study investigates the clinicopathologic features of a patient with novel GMPPB mutations and
Keren J Carss et al.
American journal of human genetics, 93(1), 29-41 (2013-06-19)
Congenital muscular dystrophies with hypoglycosylation of α-dystroglycan (α-DG) are a heterogeneous group of disorders often associated with brain and eye defects in addition to muscular dystrophy. Causative variants in 14 genes thought to be involved in the glycosylation of α-DG
B Ning et al.
European journal of biochemistry, 267(23), 6866-6874 (2000-11-18)
GDP-Man, the mannosyl donor for most Man-containing polymers is formed by the transfer of Man-1-P to GTP to form GDP-Man and PPi. This reaction is catalyzed by the widespread and essential enzyme, GDP-Man pyrophosphorylase (GMPP). The pig liver GMPP consists

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service