This product is dialyzed in water before lyophilization and contains no buffers, salts or additives. The material is soluble in water at 1 mg/mL. For assay purposes, the product is reconstituted at 1 mg/mL in 0.85% NaCl.
Select a Size
| Size/SKU | Availability | Price |
|---|---|---|
0.2 mg | Please contact Customer Service for Availability | 478,00 PLN |
0.5 mg | Please contact Customer Service for Availability | 823,00 PLN |
1 mg | Please contact Customer Service for Availability | 1.540,00 PLN |
2 mg | Please contact Customer Service for Availability | 2.830,00 PLN |
About This Item
biological source
bovine
Quality Segment
recombinant
expressed in E. coli
assay
≥98% (SDS-PAGE)
form
lyophilized powder
mol wt
Mw 19000.9 by amino acid sequence
composition
Protein, ≥85%
UniProt accession no.
storage temp.
−20°C
Gene Information
bovine ... CALM(100297344)
General description
MGSSHHHHHHSSGLVPRGSHMADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Application
Biochem/physiol Actions
Preparation Note
1 of 1
This Item | |||
|---|---|---|---|
| description recombinant, expressed in E. coli, lyophilized powder, ≥98% (SDS-PAGE) | description BioUltra, ≥98% (SDS-PAGE), lyophilized powder, essentially salt free | description lyophilized powder, 2,500-10,000 units/mg protein | description recombinant, expressed in HEK 293 cells |
| recombinant expressed in E. coli | recombinant - | recombinant - | recombinant expressed in HEK 293 cells |
| biological source bovine | biological source bovine testis | biological source bovine heart | biological source rabbit |
| assay ≥98% (SDS-PAGE) | assay ≥98% (SDS-PAGE) | assay - | assay - |
| mol wt Mw 19000.9 by amino acid sequence | mol wt 16.79 kDa | mol wt - | mol wt calculated mol wt 47.58 kDa, observed mol wt ~45 kDa |
| form lyophilized powder | form lyophilized powder | form lyophilized powder | form lyophilized |
| UniProt accession no. | UniProt accession no. | UniProt accession no. | UniProt accession no. |
Storage Class
11 - Combustible Solids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
-
How was the protein lyophilized? What was the buffer, it's concentration and volume?
1 answer-
Helpful?
-



