SerPINE1 is a serine proteinase inhibitor that blocks fibrinolysis by inhibiting tissue plasminogen activator (tPA) and urokinase (uPA). Genetic variations in SERPINE1 have been linked to pre-eclampsia (PE). Studies have reported that targeting SERPINE1 (PAI-1) expression in Alzheimer′s disease may have therapeutic implications. Moreover, MiR-34c regulates SERPINE1 expression in emphysema. Rabbit Anti-SerPINE1 antibody recognizes pig, human, mouse, rat, and bovine SERPINE1.
Immunogen
Synthetic peptide directed towards the N terminal region of human SERPINE1
Application
Rabbit Anti-SerPINE1 antibody is suitable for western blot applications at a concentration of 1 μg/ml.
Biochem/physiol Actions
SERPINE1 acts as ′bait′ for tissue plasminogen activator, urokinase, and protein C. Its rapid interaction with TPA may function as a major control point in the regulation of fibrinolysis.
Sequence
Synthetic peptide located within the following region: VAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQ
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
MicroRNAs (MiRNA) are small non-coding RNAs that regulate gene expression. The aim of this study was to identify miRNAs differentially expressed between mild and moderately emphysematous lung, as well as their functional target mRNAs. Resected lung from patients with COPD
Molecular Medicine & Therapeutics, 1(2), 106-106 (2013-07-13)
Accumulation of neurotoxic amyloid peptides (Aβ) in the brain, generated by β-site proteolytic processing of the amyloid precursor protein (APP), is the hallmark pathophysiologic feature of Alzheimer's disease. The plasmin-activating cascade, in which urokinase (uPA) and tissue-type (tPA) plasminogen activators
Molecular human reproduction, 19(3), 136-143 (2012-11-28)
The SERPINE1 -675 4G/5G promoter region insertion/deletion polymorphism (rs1799889) has been implicated in the pathogenesis of pre-eclampsia (PE), but the genetic association has been inconsistently replicated. To derive a more precise estimate of the association, a systematic review and meta-analysis
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
