SAB2108409

Anti-SLC5A2 antibody produced in rabbit

affinity isolated antibody

• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 73kDa
• species reactivity: human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunoblotting: suitable
• NCBI accession no.: NM_133254
• UniProt accession no.: Q923I7
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SLC5A2(6524)

Description

Immunogen

The immunogen for anti-SLC5A2 antibody: synthetic peptide directed towards the middle region of human SLC5A2

Biochem/physiol Actions

Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na+/glucose cotransporter arranged in series along kidney proximal tubules.

Sequence

Synthetic peptide located within the following region: SSTCYQPRPDSYHLLRDPVTGDLPWPALLLGLTIVSGWYWCSDQVIVQRC

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 12 - Non Combustible Liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable