Saltar al contenido
Merck
Todas las fotos(2)

Documentos clave

AV49500

Sigma-Aldrich

Anti-PLXDC1 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-DKFZp686F0937, Anti-FLJ36270, Anti-FLJ45632, Anti-Plexin domain containing 1, Anti-TEM3, Anti-TEM7

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

54 kDa

reactividad de especies

dog, human, rat, mouse

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... PLXDC1(57125)

Inmunógeno

Synthetic peptide directed towards the N terminal region of human PLXDC1

Aplicación

Anti-PLXDC1 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Acciones bioquímicas o fisiológicas

Plexin domain containing 1 (PLXDC1; tumor endothelial marker 7, TEM7) is a transmembrane and secreted protein containing plexin-like and weak nidogen-like domains. It mediates protein-protein interactions and is associated with angiogenic state of these cells. It is highly expressed in endothelium of tumor cells in a variety of cancer types.

Secuencia

Synthetic peptide located within the following region: MDTLPDNRTRVVEDNHSYYVSRLYGPSEPHSRELWVDVAEANRSQVKIHT

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Rebecca G Bagley et al.
Microvascular research, 82(3), 253-262 (2011-10-01)
Antiangiogenesis has been validated as a therapeutic strategy to treat cancer, however, a need remains to identify new targets and therapies for specific diseases and to improve clinical benefit from antiangiogenic agents. Tumor endothelial marker 7 (TEM-7) was investigated as
Judy R van Beijnum et al.
Frontiers in bioscience (Scholar edition), 1, 216-225 (2009-06-02)
Endothelial cells (EC) are attractive targets for therapeutic interference in diseases that are dependent on the formation of novel blood vessels, such as cancer. EC are readily accessible via the blood stream and are considered to be genetically stable, thus
Akash Nanda et al.
Cancer research, 64(23), 8507-8511 (2004-12-03)
Tumor endothelial marker 7 (TEM7) was recently identified as an mRNA transcript overexpressed in the blood vessels of human solid tumors. Here, we identify several new variants of TEM7, derived by alternative splicing, that are predicted to be intracellular (TEM7-I)

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico