Saltar al contenido
Merck
Todas las fotos(2)

Documentos clave

AV38278

Sigma-Aldrich

Anti-TEAD3 (AB2) antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-TEA domain family member 3

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.43
El producto AV38278 no se vende actualmente en su país Póngase en contacto con el Servicio técnico

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

49 kDa

reactividad de especies

mouse, rabbit, bovine, guinea pig, rat, dog, human, horse

concentración

0.5 mg - 1 mg/mL

técnicas

immunohistochemistry: suitable
western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... TEAD3(7005)

Inmunógeno

Synthetic peptide directed towards the C terminal region of human TEAD3

Acciones bioquímicas o fisiológicas

TEAD3 is a member of the transcriptional enhancer factor (TEF) family. The family members contain the TEA/ATTS DNA-binding domain. This member is preferentially expressed in placenta and transactivates the chorionic somatomammotropin gene enhancer.This gene encodes a member of the transcriptional enhancer factor (TEF) family. The family members contain the TEA/ATTS DNA-binding domain. This member is preferentially expressed in placenta and transactivates the chorionic somatomammotropin gene enhancer. The protein is encoded through the use of a non-AUG (ATA) translation initiation codon.This gene encodes a member of the transcriptional enhancer factor (TEF) family. The family members contain the TEA/ATTS DNA-binding domain. This member is preferentially expressed in placenta and transactivates the chorionic somatomammotropin gene enhancer. The protein is encoded through the use of a non-AUG (ATA) translation initiation codon.

Secuencia

Synthetic peptide located within the following region: MMNSVLENFTILQVVTSRDSQETLLVIAFVFEVSTSEHGAQHHVYKLVKD

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 2

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Y Zhou et al.
Oncogene, 36(47), 6518-6530 (2017-08-02)
TEA domain (TEAD) transcription factors are key components of the Hippo-YAP1 signaling pathway, but their functional role and regulatory mechanisms remain unclear. This study aims to comprehensively explore the expression pattern and functional role of TEAD family in gastric carcinogenesis

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico