Skip to Content
Merck
All Photos(2)

Documents

HPA002548

Sigma-Aldrich

Anti-HUWE1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-ARF-BP1 antibody produced in rabbit, Anti-ARF-binding protein 1 antibody produced in rabbit, Anti-E3 ubiquitin-protein ligase HUWE1 antibody produced in rabbit, Anti-HECT, UBA and WWE domain-containing protein 1 antibody produced in rabbit, Anti-Mcl-1 ubiquitin ligase E3 antibody produced in rabbit, Anti-Mule antibody produced in rabbit, Anti-URE-B1 antibody produced in rabbit

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

SGSSTTRLTQGIGRSQRTLRQLTANTGHTIHVHYPGNRQPNPPLILQRLLGPSAAADILQLSSSLPLQSRGRARLLVGNDDVHIIARSDDELLDDFFHDQSTATSQAGTLSSIPTALTRWTEECKVLDAESMHDCVSVVKVSIVNHLE

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... HUWE1(10075)

General description

HUWE1 (HECT, UBA and WWE domain containing 1, E3 ubiquitin protein ligase) is an E3 ubiquitin ligase. It contains a region similar to the Bcl-2 homology region 3 (BH3) domain that interacts with Mcl-1 (myeloid cell leukemia 1).
HUWE1 is mapped on the human chromosome at Xp11.22. It has a molecular weight of 482 kDa.

Immunogen

E3 ubiquitin-protein ligase HUWE1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-HUWE1 antibody produced in rabbit has been used to promote hexokinase 2′s (HK2′s) K63- linked ubiquitination.

Biochem/physiol Actions

HUWE1 (HECT, UBA and WWE domain containing 1, E3 ubiquitin protein ligase) is essential for DNA damage-induced apoptosis. It plays an important role in the stimulation of Mcl-1 polyubiquitination and regulation of apoptosis. It can directly bind with p53 to ubiquitinate it. It is inactivated by ARF and inactivation is crucial for ARF (alternative reading frame)-mediated p53 stabilization. It polyubiquitinates Cdc6 (cell division cycle 6) in vitro which is an essential component of pre-replication complexes (preRCs) during initial phase of DNA replication. The polyubiquitination helps HUWE1 to control availability of Cdc6 in post DNA damage condition.
HUWE1 is involved in base excision repair, cell proliferation and DNA damage response. The mutation in this gene is associated with Juberg-Marsidi and Brooks syndromes.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST74283

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

HUWE1 mutations in Juberg-Marsidi and Brooks syndromes: the results of an X-chromosome exome sequencing study
Friez M J, et al.
BMJ Open, 6(4), e009537-e009537 (2016)
A structural element within the HUWE1 HECT domain modulates self-ubiquitination and substrate ubiquitination activities
Pandya R K, et al.
Test, 285(8), 5664-5673 (2010)
Non-proteolytic ubiquitination of Hexokinase 2 by HectH9 controls tumor metabolism and cancer stem cell expansion
Lee H J, et al.
Nature Communications, 10(1), 2625-2625 (2019)
HUWE1 variants cause dominant X-linked intellectual disability: a clinical study of 21 patients
Moortgat S, et al.
European Journal of Human Genetics, 26(1), 64-64 (2018)
Jonathan R Hall et al.
Molecular biology of the cell, 18(9), 3340-3350 (2007-06-15)
The Cdc6 protein is an essential component of pre-replication complexes (preRCs), which assemble at origins of DNA replication during the G1 phase of the cell cycle. Previous studies have demonstrated that, in response to ionizing radiation, Cdc6 is ubiquitinated by

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service