Accéder au contenu
Merck
Toutes les photos(6)

Principaux documents

HPA003733

Sigma-Aldrich

Anti-THY1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-CD90 antigen, Anti-CDw90, Anti-Thy-1 antigen, Anti-Thy-1 membrane glycoprotein precursor

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Numéro MDL:
Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Validation améliorée

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

Technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

Séquence immunogène

VTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWL

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... THY1(7070)

Description générale

Thy-1 (Thy-1 cell surface antigen) is a 18,000Da glycoprotein belonging to the immunoglobulin supergene family. It consists of a hydrophobic segment at the carboxyl terminus and a site for N-glycosylation.
Thy-1 cell surface antigen (Thy-1)/CD90 (cluster of differentiation 90) is a 25–37 kDa glycosylphosphatidylinositol (GPI)-anchored glycoprotein. It was first detected in the T cells of mice. Thy-1 is expressed in thymocytes, T cells, neurons, hematopoietic stem cells, cancer stem cells, endothelial cells and fibroblasts. This gene is located on human chromosome 11q23.

Immunogène

Thy-1 membrane glycoprotein precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Actions biochimiques/physiologiques

Thy-1 cell surface antigen (Thy-1)/CD90 (cluster of differentiation 90) is involved in T-cell activation, neuritis outgrowth modulation, vesicular release of neurotransmitter at the synapse, astrocyte adhesion, apoptosis in carcinoma cells, tumour suppression, wound healing, fibrosis and fibrogenesis. It also controls fibroblast focal adhesion, cytoskeleton organization and cell migration.
Thy-1 is also known as CD90 (Cluster of Differentiation 90). The gene is involved in invasion and associated with epithelial-mesenchymal transition. It is a novel diagnostic marker that contributes for the diagnosis of epithelioid mesothelioma. It can act as a promising novel prognostic marker for male breast cancer. It may act as a biomarker for several tumors as well as cancer stem cells and may be involved in the progression of hepatocellular carcinoma (HCC). It may also act as a potential marker of lung cancer stem cells.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST77497

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Xiuping Yan et al.
Oncology reports, 30(6), 2733-2740 (2013-10-09)
Accumulating evidence supports that cancer stem cells (CSCs) are responsible for tumor initiation, progression, distal metastasis and even drug resistance. Although CD90 has been identified as a marker for several types of stem cells, such as liver CSCs, the potential
Caecilia Hapsari Ceriapuri Sukowati et al.
PloS one, 8(10), e76830-e76830 (2013-10-12)
Although the CD90 (Thy-1) was proposed as biomarker of several tumors and cancer stem cells, the involvement of this molecule in the progression of hepatocellular carcinoma (HCC) and other less frequent hepatic neoplasms is still undefined. The distribution of CD90
Kiyoko Kawamura et al.
American journal of clinical pathology, 140(4), 544-549 (2013-09-21)
To pathologically distinguish mesothelioma from lung carcinoma, particularly adenocarcinoma. We conducted immunohistochemical analyses on clinical specimens, including 26 cases of mesothelioma, 28 cases of lung adenocarcinoma, and 33 cases of lung squamous cell carcinoma. We found that CD90 expression was
T Seki et al.
Proceedings of the National Academy of Sciences of the United States of America, 82(19), 6657-6661 (1985-10-01)
The human Thy-1 gene has been isolated and sequenced and compared to the rat and mouse Thy-1 genes. All three genes are organized in the same way: one exon encoding the majority of the signal peptide, another encoding the transmembrane
Simone Micalizzi et al.
International journal of bioprinting, 9(5), 763-763 (2023-07-17)
Tendon and ligament injuries are relevant clinical problems in modern society, and the current medical approaches do not guarantee complete recovery of the physiological functionalities. Moreover, they present a non-negligible failure rate after surgery. Failures often occur at the enthesis

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique