Accéder au contenu
Merck
Toutes les photos(3)

Principaux documents

AV41516

Sigma-Aldrich

Anti-SLC22A1 (AB1) antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-1-Oct, Anti-HOCT1, Anti-Oct1_cds, Anti-Solute carrier family 22 (organic cation transporter), member 1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

61 kDa

Espèces réactives

bovine, rat, human, horse, guinea pig, rabbit, dog, mouse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SLC22A1(6580)

Description générale

Solute carrier family 22 (organic cation transporter), member 1 (SLC22A1, 1-Oct, HOCT1, Oct1-cds) is a transporter of organic cations (OCT) that in addition to endogenous cations include various external origin cationic toxins and drugs. Examples of drugs transported by OCT1 include metformin, amantadine, pramipexole, and, possibly, levodopa.

Spécificité

Anti-SLC22A1 (AB1) polyclonal antibody reacts with chicken, pig, bovine, rabbit, human, mouse, rat, and canine solute carrier family 22 (organic cation transporter), member 1 proteins.

Immunogène

Synthetic peptide directed towards the N terminal region of human SLC22A1

Application

Anti-SLC22A1 (AB1) polyclonal antibody is used to tag solute carrier family 22 (organic cation transporter), member 1 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 22 (organic cation transporter), member 1 in the transport of small organic cations including a variety of important drugs.

Actions biochimiques/physiologiques

Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. SLC22A1 contains twelve putative transmembrane domains and is a plasma integral membrane protein.Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein. Two transcript variants encoding two different isoforms have been found for this gene, but only the longer variant encodes a functional transporter.

Séquence

Synthetic peptide located within the following region: LSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSWKLD

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Tianxiang Kevin Han et al.
Molecular pharmacology, 84(2), 182-189 (2013-05-18)
Organic cation transporters (OCTs) are members of the solute carrier 22 family of transporter proteins that are involved in absorption, distribution, and excretion of organic cations. OCT3 is localized in the apical (AP) membrane of enterocytes, but the literature is
Metee Jinakote et al.
Fundamental & clinical pharmacology, 37(4), 833-842 (2023-02-28)
Buspirone, a cationic drug, is an anxiolytic and antidepressant drug. However, whether buspirone and its metabolites are interacted with organic cationic transporter remains uncertain. In this study, we examined the interaction of buspirone and its major metabolites 1-(2-pyrimidinyl)piperazine (1-PP) and
Ruijin Shao et al.
Journal of experimental & clinical cancer research : CR, 33, 41-41 (2014-06-03)
Although a number of in vitro studies have demonstrated the antiproliferative, anti-invasive, and antimetastatic effects of metformin in multiple cancer cell types, its cellular and molecular mechanisms of anti-cancer action in the endometrium of women with polycystic ovary syndrome (PCOS)
Raymond K Hau et al.
Drug metabolism and disposition: the biological fate of chemicals, 50(6), 770-780 (2022-03-22)
The blood-testis barrier (BTB) is formed by basal tight junctions between adjacent Sertoli cells (SCs) of the seminiferous tubules and acts as a physical barrier to protect developing germ cells in the adluminal compartment from reproductive toxicants. Xenobiotics, including antivirals
Xin Li et al.
American journal of translational research, 7(3), 574-586 (2015-06-06)
Conflicting results have been reported regarding whether or not insulin-regulated glucose transporter 4 (GLUT4) is expressed in human and rodent endometria. There is an inverse relationship between androgen levels and insulin-dependent glucose metabolism in women. Hyperandrogenemia, hyperinsulinemia, and insulin resistance

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique