Direkt zum Inhalt
Merck

HPA018139

Sigma-Aldrich

Anti-GOT2 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(e):

Anti-Aspartate aminotransferase, mitochondrial precursor, Anti-FABP-1, Anti-FABPpm, Anti-Fatty acid-binding protein, Anti-Glutamate oxaloacetate transaminase 2, Anti-Transaminase A, Anti-mAspAT

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise


About This Item

UNSPSC-Code:
12352203
Human Protein Atlas-Nummer:
NACRES:
NA.41

Biologische Quelle

rabbit

Qualitätsniveau

Konjugat

unconjugated

Antikörperform

affinity isolated antibody

Antikörper-Produkttyp

primary antibodies

Klon

polyclonal

Produktlinie

Prestige Antibodies® Powered by Atlas Antibodies

Form

buffered aqueous glycerol solution

Speziesreaktivität

mouse, rat, human

Erweiterte Validierung

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

Methode(n)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500

Immunogene Sequenz

GFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVER

UniProt-Hinterlegungsnummer

Versandbedingung

wet ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... GOT2(2806)

Allgemeine Beschreibung

The gene glutamate oxaloacetate transaminase-2 (GOT2) is located in human chromosome 16 (16q21). The protein is an aspartate aminotransfaerase (AST) enzyme. Two distinct forms of AST have been identified: a cytoplasmic (GOT1) and a mitochondrial isoform (GOT2). GOT2 has been identified within mitochondria and on the plasma membrane in HepG2 cells.

Immunogen

Aspartate aminotransferase, mitochondrial precursor recombinant protein epitope signature tag (PrEST)

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-GOT2 antibody produced in rabbit has been used in western blotting and immunohistochemistry.

Biochem./physiol. Wirkung

The protein Glutamate oxaloacetate transaminase-2 (GOT2) participates in amino acid metabolism, converting aspartate and α-ketoglutarate (aKG) to oxaloacetate (OAC) and glutamate. GOT2 also provides a major route for reducing equivalents into mitochondria through its participation in the malate:asparte shuttle. GOT2K159 acetylation increases in human pancreatic tumors. It is shown to be involved in growth of human pancreatic adenocarcinoma. Long term ethanol exposure up-regulates GOT2 levels in the plasma membrane of HepG2 cells. The protein level increases in type2 diabetes patients post exercise training. Using mass spectroscopy and nuclear magnetic resonance approach decreased level of the enzyme was observed in brains from schizophrenia-induced rats and post-mortem schizophrenia patients. Proteomic analysis of Vastus lateralis muscle in mature and older women showed down-regulation of the protein in older women, indicating its involvement in muscle aging.

Leistungsmerkmale und Vorteile

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST73325

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

WGK

WGK 1

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable

Persönliche Schutzausrüstung

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Ebru S Selen et al.
The Journal of biological chemistry, 298(12), 102648-102648 (2022-11-29)
Pyruvate has two major fates upon entry into mitochondria, the oxidative decarboxylation to acetyl-CoA via the pyruvate decarboxylase complex or the biotin-dependent carboxylation to oxaloacetate via pyruvate carboxylase (Pcx). Here, we have generated mice with a liver-specific KO of pyruvate
HIF1 alpha suppresses tumor cell proliferation through inhibition of aspartate biosynthesis
Melendez R F, et al.
Testing, 26(9), 2257-2265 (2019)
Sophie E Hussey et al.
Medicine and science in sports and exercise, 45(6), 1069-1076 (2013-01-01)
Exercise training alters protein abundance in the muscle of healthy individuals, but the effect of exercise on these proteins in patients with type 2 diabetes (T2D) is unknown. The aim of this study was to determine how exercise training alters
Silvia Sookoian et al.
World journal of gastroenterology, 21(3), 711-725 (2015-01-28)
For several decades, serum levels of alanine (ALT) and aspartate (AST) aminotransferases have been regarded as markers of liver injury, including a wide range of etiologies from viral hepatitis to fatty liver. The increasing worldwide prevalence of metabolic syndrome and
Tissue of origin dictates GOT1 dependence and confers synthetic lethality to radiotherapy
Nelson B S, et al.
Cancer & Metabolism, 8(1), 1-16 (2020)

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.