Skip to Content
Merck
All Photos(8)

Key Documents

HPA003162

Sigma-Aldrich

Anti-LGALS3 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-35 kDa lectin antibody produced in rabbit, Anti-CBP 35 antibody produced in rabbit, Anti-Carbohydrate-binding protein 35 antibody produced in rabbit, Anti-GALBP antibody produced in rabbit, Anti-Galactose-specific lectin 3 antibody produced in rabbit, Anti-Galactoside-binding protein antibody produced in rabbit, Anti-Galectin-3 antibody produced in rabbit, Anti-IgE-binding protein antibody produced in rabbit, Anti-L-31 antibody produced in rabbit, Anti-Laminin-binding protein antibody produced in rabbit, Anti-Lectin L-29 antibody produced in rabbit, Anti-Mac-2 antigen antibody produced in rabbit

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43
Pricing and availability is not currently available.

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

recombinant expression
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50

immunogen sequence

SSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVK

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... LGALS3(3958)

General description

LGALS3 (lectin, galactoside-binding, soluble, 3) gene encodes a galactose-specific lectin called ′Galectin-3′ that belongs to the galectin family of carbohydrate binding proteins. It has a molar mass of approximately 30kDa and may be localized to the extracellular matrix, the cytoplasm and the nucleus. It has a proline- and glycine-rich NH(2)-terminal domain that is fused to a single C-terminal domain that binds to galactose-containing glycoconjugates.

Immunogen

Galectin-3 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Galectin-3 functions in acute inflammation, chronic inflammation and tissue fibrogenesis and may serve as a potential therapeutic target in the treatment of various inflammatory diseases. It forms a complex with NG2 proteoglycan and alpha3beta1 integrin on the cell surface and promotes endothelial cell motility and morphogenesis during early stages of neovascularization. It associates with Bcl-2, an apoptosis repressor in the cytoplasm and exhibit anti-apoptotic activity. Gal-3 also serves as a pre-mRNA splicing factor by interacting with the U1 small nuclear ribonucleoprotein (snRNP) complex. It is found to be involved in the progression and metastasis of several types of tumors. It is found to participate in the regulation of T-cell functions.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70617

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Kevin C Haudek et al.
Biochimica et biophysica acta, 1800(2), 181-189 (2009-07-21)
This review summarizes selected studies on galectin-3 (Gal3) as an example of the dynamic behavior of a carbohydrate-binding protein in the cytoplasm and nucleus of cells. Within the 15-member galectin family of proteins, Gal3 (M(r) approximately 30,000) is the sole
Daniel K Hsu et al.
Immunological reviews, 230(1), 114-127 (2009-07-15)
Galectin-3 is absent in resting CD4+ and CD8+ T cells but is inducible by various stimuli. These include viral transactivating factors, T-cell receptor (TCR) ligation, and calcium ionophores. In addition, galectin-3 is constitutively expressed in human regulatory T cells and
Neil C Henderson et al.
Immunological reviews, 230(1), 160-171 (2009-07-15)
Galectin-3 is a beta-galactoside-binding animal lectin of approximately 30 kDa and is evolutionarily highly conserved. Galectin-3 is promiscuous, its localization within the tissue micro-environment may be extracellular, cytoplasmic, or nuclear, and it has a concentration-dependent ability to be monomeric or
Jun-ichi Fukushi et al.
Molecular biology of the cell, 15(8), 3580-3590 (2004-06-08)
The NG2 proteoglycan is expressed by microvascular pericytes in newly formed blood vessels. We have used in vitro and in vivo models to investigate the role of NG2 in cross-talk between pericytes and endothelial cells (EC). Binding of soluble NG2
Marika Kucińska et al.
Cell communication and signaling : CCS, 17(1), 65-65 (2019-06-19)
Fibroblast growth factor receptors (FGFRs) are integral membrane proteins that transmit signals through the plasma membrane. FGFRs signaling needs to be precisely adjusted as aberrant FGFRs function is associated with development of human cancers or severe metabolic diseases. The subcellular

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service