AV47876

Anti-LAB antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-BG:DS00004.9, Anti-CG1264, Anti-DmLab, Anti-Dmel_CG1264, Anti-EfR9, Anti-F121, Anti-F24
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 54 kDa
• species reactivity: human, Drosophila
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_476613
• UniProt accession no.: P10105
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: Drosophila melanogaster ... lab(40817)

Description

General description

Labial (LAB) is a Drosophila transcription factor that regulates brain, midgut and embryo development. It is also known to modulate cell fate decisions and cell differentiation.
Rabbit Anti-LAB antibody recognizes Drosophila LAB.

Immunogen

Synthetic peptide corresponding to a region of Fruit fly

Application

Rabbit Anti-LAB antibody is suitable for western blot applications at a concentration of 1μg/ml and for IHC at 4-8μg/ml.

Biochem/physiol Actions

lab is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It is required for proper head development.

Sequence

Synthetic peptide located within the following region: MMDVSSMYGNHPHHHHPHANAYDGYSTTTASAANASSYFAPQQHQPHLQL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 12 - Non Combustible Liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable