ARNTL is a basic helix-loop-helix protein that associates with CLOCK to form a heterodimer. ARNTL may be involved in p53-mediated tumor suppression. Furthermore, ARNTL may be linked to bipolar disorder. Rabbit Anti-ARNTL (AB1) antibody recognizes bovine, pig, canine, human, mouse, and rat ARNTL.
Immunogen
Synthetic peptide directed towards the N terminal region of human ARNTL
Application
Rabbit Anti-ARNTL (AB1) antibody can be used for IHC (4-8μg/ml, using paraffin-embedded tissues) and western blot (5μg/ml) assays.
Biochem/physiol Actions
ARNTL is a general dimerization partner for a subset of the basic-helix-loop-helix (bHLH)-PER-ARNT-SIM (PAS) superfamily of transcriptional regulators.
Sequence
Synthetic peptide located within the following region: TDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSF
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
The p53 tumor suppressor gene is mutated in about half of human cancers, but the p53 pathway is thought to be functionally inactivated in the vast majority of cancer. Understanding how tumor cells can become insensitive to p53 activation is
American journal of medical genetics. Part B, Neuropsychiatric genetics : the official publication of the International Society of Psychiatric Genetics, 141B(3), 234-241 (2006-03-11)
Bipolar affective disorder (BPAD) is suspected to arise in part from malfunctions of the circadian system, a system that enables adaptation to a daily and seasonally cycling environment. Genetic variations altering functions of genes involved with the input to the
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.