WH0083881M2

Monoclonal Anti-MIXL1 antibody produced in mouse

clone 4D11, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-MGC138179, Anti-MILD1, Anti-MIXL, Anti-Mix1 homeobox-like 1 (Xenopus laevis)
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 4D11, monoclonal
• 양식: buffered aqueous solution
• 종 반응성: human
• 기술: indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgGκ
• GenBank 수납 번호: NM_031944
• UniProt 수납 번호: Q9H2W2
• 배송 상태: dry ice
• 저장 온도: −20°C
• 유전자 정보: human ... MIXL1(83881)

설명

일반 설명

Mix paired-like homeobox, also known as mesoderm inducer in Xenopus like 1 (MIXL1), is a homeobox transcription factor. It is induced by the transforming growth factor-β family of ligands. MIXL1 is expressed in hematopoietic stem cells and progenitor cells. The gene encoding it is localized on human chromosome 1q42.12.[1][2]

면역원

MIXL1 (NP_114150, 86 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QRRKRTSFSAEQLQLLELVFRRTRYPDIHLRERLAALTLLPESRIQVWFQNRRAKSRRQSGKSFQPLARPEIILNHCAPGTETKCLKPQLPLEVDVNCLP

생화학적/생리학적 작용

Mesoderm inducer in Xenopus like 1 (MIXL1) is crucial for specification of the mesoderm and endoderm during early embryogenesis. It modulates the proto-oncogene c-REL. The protein may have a role in acute myelogenous leukemia.[2]

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: nwg
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)