콘텐츠로 건너뛰기
Merck
모든 사진(7)

주요 문서

WH0064399M1

Sigma-Aldrich

Monoclonal Anti-HHIP antibody produced in mouse

clone 5D11, purified immunoglobulin, buffered aqueous solution

동의어(들):

Anti-FLJ20992, Anti-FLJ90230, Anti-HIP, Anti-hedgehog interacting protein

로그인조직 및 계약 가격 보기

크기 선택

100 μG
₩863,867

₩863,867

예상 입고일2025년 8월 20일세부사항

모든 사진(7)

크기 선택

보기 변경
100 μG
₩863,867

About This Item

MDL number:
MFCD01094561
UNSPSC 코드:
12352203
NACRES:
NA.41

₩863,867

예상 입고일2025년 8월 20일세부사항

생물학적 소스

mouse

Quality Level

100

결합

unconjugated

항체 형태

purified immunoglobulin

항체 생산 유형

primary antibodies

클론

5D11, monoclonal

양식

buffered aqueous solution

종 반응성

rat, human, mouse

기술

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

동형

IgG2bκ

GenBank 수납 번호

NM_022475

UniProt 수납 번호

Q96QV1

배송 상태

dry ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... HHIP(64399)

관련 카테고리

일반 설명

This gene encodes a protein similar to the mouse hedgehog-interacting protein, a regulatory component of the hedgehog signalling pathway. Members of the hedgehog family are evolutionarily conserved proteins which are involved in many fundamental processes in embryonic development, including anteroposterior patterns of limbs and regulation of left-right asymmetry. (provided by RefSeq)

면역원

HHIP (NP_071920, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQ

애플리케이션

Monoclonal Anti-HHIP antibody produced in mouse has been used in immnohistochemistry.

생화학적/생리학적 작용

The gene encoding HHIP (hedgehog interacting protein) is located on human chromosome 4, and encodes for a protein belonging to the hedgehog-interacting protein (HHIP) family. Hedgehog (HH) proteins are evolutionarily conserved proteins, and are important morphogens for a vast range of developmental processes, like regulation of left-right asymmetry and anteroposterior patterns of limbs during embryonic development. HH signals are regulated by numerous cell-surface receptors. HHIP encoded by this gene is highly conserved and interacts with all the three HH family members namely SHH (sonic hh), IHH (indian hh) and DHH (desert hh). It is also a vertebrate-specific inhibitor of HH signaling. Single nucleotide polymorphisms (SNPs) in HHIP gene is associated with increase in the risk of chronic obstructive pulmonary disease (COPD).

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

nwg

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number
F7301-5D11
D3151-5D11
08333-5D11
08256-5D11
06146-5D11

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

COA 검색

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Hhip haploinsufficiency sensitizes mice to age-related emphysema
Taotao Lao
Proceedings of the National Academy of Sciences of the USA (2016)
Association of HHIP polymorphisms with COPD and COPD-related phenotypes in a Chinese Han population.
Wang B
Gene (2013)
Epigenetic regulation of human hedgehog interacting protein in glioma cell lines and primary tumor samples.
Shahi MH
Tumour Biology : the Journal of the International Society For Oncodevelopmental Biology and Medicine (2015)
Gene expression analysis uncovers novel hedgehog interacting protein (HHIP) effects in human bronchial epithelial cells.
Zhou X
Genomics (2013)
Shh-mediated degradation of Hhip allows cell autonomous and non-cell autonomous Shh signalling.
Kwong L
Nature Communications (2014)
모든 관련된 서류 보기

질문

  1. Could you please provide information on the protocol used for the validation of the HHIP antibody WH0064399M1 in chromogenic IHC on FFPE? I am particularly interested in the dilution, secondaries, and control tissue information.

    1 답변

    1. The antibody was successfully validated for formalin-fixed paraffin-embedded human heart tissue using the following protocol:

      1. Deparaffinize the paraffin-embedded sections by heating at 57°C for 60 minutes and rehydrate for 3 minutes in the following solutions: 2x xylene, 1x xylene:100% ethanol, 2x 100% ethanol, 1x 95% ethanol, 70% ethanol, 50% ethanol, and cold tap water.

      2. Perform heat-induced epitope retrieval in 1 X citrate buffer (pH 6.0) and microwave at 750 W for 20 minutes.

      3. Quench endogenous peroxidase activity with 0.1% H2O2 for 20 minutes.

      4. Permeabilize with 0.05% saponin diluted in PBS for 5 minutes.

      5. Use the Vectastain Elite ABC Universal Kit for immunohistochemical detection per the manufacturer's instructions.

      6. Incubate sections with primary antibody anti-HHIP clone M01 WH0064399M1-100UG (1:100) at 4°C overnight. Omit primary antibodies for negative controls.

      7. Visualize immunoreactivity with 3,3'-diaminobenzidine (DAB) substrate.

      8. Counterstain cells for 30 seconds with hematoxylin and mount with Mowiol.

      9. Examine staining under an inverted light microscope and digitally record at 40x magnification.

      도움이 되었습니까?

후기

평점 값 없음

활성 필터

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.