콘텐츠로 건너뛰기
Merck
모든 사진(5)

주요 문서

WH0064093M3

Sigma-Aldrich

Monoclonal Anti-SMOC1 antibody produced in mouse

clone 8F10, purified immunoglobulin, buffered aqueous solution

동의어(들):

Anti-SPARC related modular calcium binding 1

로그인조직 및 계약 가격 보기

크기 선택

100 μG
₩930,349

₩930,349


예상 입고일2025년 4월 21일세부사항



크기 선택

보기 변경
100 μG
₩930,349

About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

₩930,349


예상 입고일2025년 4월 21일세부사항


생물학적 소스

mouse

Quality Level

결합

unconjugated

항체 형태

purified immunoglobulin

항체 생산 유형

primary antibodies

클론

8F10, monoclonal

양식

buffered aqueous solution

종 반응성

human

기술

indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

동형

IgG2aκ

GenBank 수납 번호

UniProt 수납 번호

배송 상태

dry ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... SMOC1(64093)

일반 설명

SPARC related modular calcium binding 1 (SMOC1) is an extracellular glycoprotein belonging to the SPARC family. It is localized and secreted in bone marrow derived mesenchymal stem cells (BMSCs) stimulated with osteogenic medium (OSM). The protein is expressed in the developing optic stalk, ventral optic cup, and limbs of mouse embryos. It is composed of five domains, an N-terminal follistatin-like (FS) domain, two thyroglobulin-like (TY) domains similar to SMOC, and an extracellular calcium-binding (EC) domain.

면역원

SMOC1 (NP_071420, 150 a.a. ~ 221 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SVQNKTPVCSGSVTDKPLSQGNSGRKDDGSKPTPTMETQPVFDGDEITAPTLWIKHLVIKDSKLNNTNIRNS

생화학적/생리학적 작용

SMOC1 plays an essential role in ocular and limb development. It participates in the regulation of cell-matrix interaction by binding to many cell-surface receptors, the extracellular matrix, growth factors, and cytokines. It also functions in bone morphogenetic proteins (BMP) signaling cascade. Mutation in SMOC1 causes a rare autosomal-recessive disorder, microphthalmia and limb anomalies (MLA).

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

nwg

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Hana Abouzeid et al.
American journal of human genetics, 88(1), 92-98 (2011-01-05)
Waardenburg anophthalmia syndrome, also known as microphthalmia with limb anomalies, ophthalmoacromelic syndrome, and anophthalmia-syndactyly, is a rare autosomal-recessive developmental disorder that has been mapped to 10p11.23. Here we show that this disease is heterogeneous by reporting on a consanguineous family, not
Young-Ae Choi et al.
Journal of proteome research, 9(6), 2946-2956 (2010-04-03)
Extracellular matrix proteins have been implicated in the regulation of osteoblast differentiation of bone marrow derived mesenchymal stem cells (BMSCs) through paracrine or autocrine mechanisms. In the current study, we analyzed the secretory protein profiles of BMSCs grown in osteogenic
Ippei Okada et al.
American journal of human genetics, 88(1), 30-41 (2011-01-05)
Microphthalmia with limb anomalies (MLA) is a rare autosomal-recessive disorder, presenting with anophthalmia or microphthalmia and hand and/or foot malformation. We mapped the MLA locus to 14q24 and successfully identified three homozygous (one nonsense and two splice site) mutations in

질문

후기

평점 값 없음

활성 필터

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.