WH0051232M1

Monoclonal Anti-CRIM1 antibody produced in mouse

clone 6E4, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-S52, Anti-cysteine-rich motor neuron 1
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 6E4, monoclonal
• 양식: buffered aqueous solution
• 종 반응성: human
• 기술: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG2aκ
• GenBank 수납 번호: NM_016441
• UniProt 수납 번호: Q9NZV1
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... CRIM1(51232)

설명

일반 설명

The gene encoding cysteine-rich motor neuron 1 (CRIM1) is localized on human chromosome 2p21. It is a putative transmembrane protein which possesses an insulin-like growth factor (IGF)-binding protein motif and multiple cysteine-rich repeats. CRIM1 is an antagonist of bone morphogenetic proteins. The CRIM1 gene encodes a type I transmembrane protein that is mainly expressed in angiogenic endothelial cells.

면역원

CRIM1 (NP_057525, 36 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VCLPCDESKCEEPRNCPGSIVQGVCGCCYTCASQRNESCGGTFGIYGTCDRGLRCVIRPPLNGDSLTEYEAGVCEDENWTDDQLLGFKPCNENLIAGCNIINGKCECNTI

애플리케이션

Monoclonal Anti-CRIM1 antibody produced in mouse has been used in Western blotting.

생화학적/생리학적 작용

Cysteine-rich motor neuron 1 (CRIM1) may interact with growth factors implicated in motor neuron differentiation and survival. It may have a role in the development of the central nervous system (CNS). CRIM1 influences the adhesion and migration of cancer cells. It modulates the maturation of bone morphogenetic preprotein.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: nwg
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)