콘텐츠로 건너뛰기
Merck
모든 사진(2)

주요 문서

WH0023569M1

Sigma-Aldrich

Monoclonal Anti-PADI4 antibody produced in mouse

clone 4D8, purified immunoglobulin, buffered aqueous solution

동의어(들):

Anti-PAD, Anti-PADI5, Anti-PDI4, Anti-PDI5, Anti-peptidyl arginine deiminase, type IV

로그인조직 및 계약 가격 보기


About This Item

MDL number:
UNSPSC 코드:
12352203
NACRES:
NA.41
가격 및 재고 정보를 현재 이용할 수 없음 고객지원팀으로 연락바랍니다.

생물학적 소스

mouse

Quality Level

결합

unconjugated

항체 형태

purified immunoglobulin

항체 생산 유형

primary antibodies

클론

4D8, monoclonal

양식

buffered aqueous solution

종 반응성

human

기술

immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

동형

IgG2bκ

GenBank 수납 번호

UniProt 수납 번호

배송 상태

dry ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... PADI4(23569)

일반 설명

Peptidyl arginine deiminase 4 (PADI4) is one of the four PADIs found in humans. The protein consists of 663 amino acids. PADI4 gene is localized to human chromosome 1p36. It is expressed in hematopoietic tissues, such as spleen, thymus, peripheral blood leukocytes, fetal liver and bone marrow.

면역원

PADI4 (NP_004247, 2 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AQGTLIRVTPEQPTHAVCVLGTLTQLDICSSAPEDCTSFSINASPGVVVDIAHSPPAKKKSTGSSTWPLDPGVEVTLTMKAASGSTGDQKVQISYYGPKTPPVKALLYL

생화학적/생리학적 작용

Peptidyl arginine deiminase 4 (PADI4) is responsible for the post-translational conversion of peptidylarginine to citrulline, in the presence of calcium ions. In individuals with rheumatoid arthritis (RA), this gene is expressed in hematological cells and synovial tissues, and variant in this gene is linked with susceptibility to RA. The expression of this protein is linked with DNA hypermethylation in acute promyelocytic leukemia (APL).

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

A novel PAD4/SOX4/PU.1 signaling pathway is involved in the committed differentiation of acute promyelocytic leukemia cells into granulocytic cells.
Song G, et.al
Oncotarget, 7(3), 3144-3157 (2016)
Localization of peptidylarginine deiminase 4 (PADI4) and citrullinated protein in synovial tissue of rheumatoid arthritis.
Chang X, et.al
Rheumatology (Oxford, England), 44(1), 40-50 (2005)
Functional haplotypes of PADI4, encoding citrullinating enzyme peptidylarginine deiminase 4, are associated with rheumatoid arthritis.
Suzuki A, et.al
Nature Genetics, 34(4), 395-402 (2003)
Functional haplotypes of PADI4, encoding citrullinating enzyme peptidylarginine deiminase 4, are associated with rheumatoid arthritis.
Suzuki A et al
Nature Genetics, 34(4), 395-402 (2003)
A novel PAD4/SOX4/PU.1 signaling pathway is involved in the committed differentiation of acute promyelocytic leukemia cells into granulocytic cells.
Song G et al
Oncotarget, 7(3), 3144-3157 (2016)

질문

후기

평점 값 없음

활성 필터

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.