추천 제품
생물학적 소스
mouse
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
2C3, monoclonal
형태
buffered aqueous solution
종 반응성
human
기술
indirect ELISA: suitable
western blot: 1-5 μg/mL
동형
IgG2aκ
GenBank 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... SNCG(6623)
일반 설명
Synuclein gamma (SNCG) gene encodes a member of the synuclein family of proteins which are believed to be involved in the pathogenesis of neurodegenerative diseases. Mutations in this gene have also been associated with breast tumor development. (provided by RefSeq).
Synuclein gamma (SNCG) is a breast cancer specific gene. SNCG is highly expressed in malignant cancer cells and neuronal cells. SNCG gene is located on human chromosome 10q23.2. SNCG is a member of the brain protein synuclein family.
Synuclein gamma (SNCG) is a breast cancer specific gene. SNCG is highly expressed in malignant cancer cells and neuronal cells. SNCG gene is located on human chromosome 10q23.2. SNCG is a member of the brain protein synuclein family.
면역원
SNCG (AAH14098, 21 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD
Sequence
KTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD
애플리케이션
Monoclonal Anti-SNCG antibody produced in mouse has been used in western blotting.
생화학적/생리학적 작용
Synuclein gamma (SNCG) induces migration, invasion and metastasis of tumor cells. It promotes the migration of human breast adenocarcinoma cell line (MCF7) by activating extracellular-signal regulated kinase (Erk) pathway and disrupting cell-cell junctions. SNCG is associated with breast or ovarian cancer progression. Urine SNCG is used as a prognostic biomarker for bladder cancer.
물리적 형태
Solution in phosphate buffered saline, pH 7.4
법적 정보
GenBank is a registered trademark of United States Department of Health and Human Services
Not finding the right product?
Try our 제품 선택기 도구.
Storage Class Code
10 - Combustible liquids
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
개인 보호 장비
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Synuclein γ compromises spindle assembly checkpoint and renders resistance to antimicrotubule drugs
Miao S, et al.
Molecular Cancer Therapeutics (2014)
Synuclein-γ promotes migration of MCF7 breast cancer cells by activating extracellular-signal regulated kinase pathway and breaking cell-cell junctions
Zhuang Q, et al.
Molecular Medicine Reports, 12(3) (2015)
γ synuclein, a novel heat-shock protein-associated chaperone, stimulates ligand-dependent estrogen receptor $\alpha$ signaling and mammary tumorigenesis
Jiang Y, et al.
Cancer Research, 64(13) (2004)
Urine gamma-synuclein as a biomarker for the diagnosis of bladder cancer
Liu C, et al.
Oncotarget, 7(28), 43432-43432 (2016)
The future of genetic association studies in Alzheimer disease
Finckh U, et al.
Journal of neural transmission (Vienna, Austria : 1996), 110(3), 253-266 (2003)
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.