WH0006388M1

Monoclonal Anti-SDF2 antibody produced in mouse

clone 3G7-1D6, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-stromal cell-derived factor 2
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 3G7-1D6, monoclonal
• 형태: buffered aqueous solution
• 종 반응성: human
• 기술: indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG1κ
• GenBank 수납 번호: BC000500
• UniProt 수납 번호: Q99470
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... SDF2(6388)

설명

일반 설명

The protein encoded by this gene is believed to be a secretory protein. It has regions of similarity to hydrophilic segments of yeast mannosyltransferases. Its expression is ubiquitous and the gene appears to be relatively conserved among mammals. (provided by RefSeq)

면역원

SDF2 (AAH00500.1, 20 a.a. ~ 211 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SLGVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVCERGTPIKCGQPIRLTHVNTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDYLDDWTVLCNGPYWVRDGEVRFKHSSTEVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEGIFMKPSELLKAEAHHAEL

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)