WH0006241M1

Monoclonal Anti-RRM2 antibody produced in mouse

clone 1E1, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Rrm2 Antibody, Rrm2 Antibody - Monoclonal Anti-RRM2 antibody produced in mouse, Anti-R2, Anti-RR2M, Anti-ribonucleotide reductase M2 polypeptide
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 1E1, monoclonal
• 양식: buffered aqueous solution
• 종 반응성: human
• 기술: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; immunoprecipitation (IP): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• 동형: IgG1κ
• GenBank 수납 번호: NM_001034
• UniProt 수납 번호: P31350
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... RRM2(6241)

설명

일반 설명

The ribonucleotide reductase regulatory subunit M2 (RRM2) gene is located on the human chromosome at 2p25.1. RRM2 protein is a component of ribonucleotide reductase (RR). This protein is a dimer and each dimer consists of tyrosine free-radical and non-heme iron.

면역원

RRM2 (NP_001025, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLS

애플리케이션

Monoclonal Anti-RRM2 antibody produced in mouse has been used in:

• immunohistochemistry
• western blotting
• immunofluorescence

생화학적/생리학적 작용

Ribonucleotide reductase regulatory subunit M2 (RRM2) protein regulates the activity of ribonucleotide reductase (RR) during the G1/early S phase of the cell cycle when DNA replication takes place. This protein provides the essential precursors for DNA synthesis. RRM2 protein catalyzes the biogenesis of deoxyribonucleotides from their corresponding ribonucleotides. RRM2 protein acts as a biomarker for various human cancers. Overexpression of RRM2 gene is observed during tumor progression, cellular response to DNA damage and increased cellular invasiveness.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)