콘텐츠로 건너뛰기
Merck
모든 사진(6)

주요 문서

WH0006241M1

Sigma-Aldrich

Monoclonal Anti-RRM2 antibody produced in mouse

clone 1E1, purified immunoglobulin, buffered aqueous solution

동의어(들):

Rrm2 Antibody, Rrm2 Antibody - Monoclonal Anti-RRM2 antibody produced in mouse, Anti-R2, Anti-RR2M, Anti-ribonucleotide reductase M2 polypeptide

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41
가격 및 재고 정보를 현재 이용할 수 없음 고객지원팀으로 연락바랍니다.

생물학적 소스

mouse

Quality Level

결합

unconjugated

항체 형태

purified immunoglobulin

항체 생산 유형

primary antibodies

클론

1E1, monoclonal

양식

buffered aqueous solution

종 반응성

human

기술

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
immunoprecipitation (IP): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

동형

IgG1κ

GenBank 수납 번호

UniProt 수납 번호

배송 상태

dry ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... RRM2(6241)

일반 설명

The ribonucleotide reductase regulatory subunit M2 (RRM2) gene is located on the human chromosome at 2p25.1. RRM2 protein is a component of ribonucleotide reductase (RR). This protein is a dimer and each dimer consists of tyrosine free-radical and non-heme iron.

면역원

RRM2 (NP_001025, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLS

애플리케이션

Monoclonal Anti-RRM2 antibody produced in mouse has been used in:
  • immunohistochemistry
  • western blotting
  • immunofluorescence

생화학적/생리학적 작용

Ribonucleotide reductase regulatory subunit M2 (RRM2) protein regulates the activity of ribonucleotide reductase (RR) during the G1/early S phase of the cell cycle when DNA replication takes place. This protein provides the essential precursors for DNA synthesis. RRM2 protein catalyzes the biogenesis of deoxyribonucleotides from their corresponding ribonucleotides. RRM2 protein acts as a biomarker for various human cancers. Overexpression of RRM2 gene is observed during tumor progression, cellular response to DNA damage and increased cellular invasiveness.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

A novel protein-based prognostic signature improves risk stratification to guide clinical management in early-stage lung adenocarcinoma patients
Martinez T E, et al.
The Journal of Pathology, 245(4), 421-432 (2018)
RRM2 induces NF-kappaB-dependent MMP-9 activation and enhances cellular invasiveness
Duxbury M S and Whang E E
Biochemical and biophysical research communications, 354(1), 190-196 (2007)
Potent siRNA inhibitors of ribonucleotide reductase subunit RRM2 reduce cell proliferation in vitro and in vivo
Heidel J D, et al.
Current Rheumatology Reports, 13(7), 2207-2215 (2007)
Systemic delivery of siRNA nanoparticles targeting RRM2 suppresses head and neck tumor growth
Rahman M A, et al.
Journal of Controlled Release : Official Journal of the Controlled Release Society, 159(3), 384-392 (2012)
Presence of 2p25. 3 Duplication and 2q37. 3 Microdeletion Syndrome in the Same Individual
Moreno L J, et al.
2016 Oncology Nursing Drug Handbook, 27(2), 73-84 (2019)

질문

후기

평점 값 없음

활성 필터

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.