WH0005791M4
Monoclonal Anti-PTPRE antibody produced in mouse
clone 2D10, purified immunoglobulin, buffered aqueous solution
동의어(들):
Anti-DKFZp313F1310, Anti-HPTPE, Anti-PTPE, Anti-RPTPEPSILON, Anti-protein tyrosine phosphatase, receptor type, E
로그인조직 및 계약 가격 보기
크기 선택
100 μG
₩824,891
₩824,891
구입 가능 여부는 고객센터에 문의하십시오.
기존과 동일한 품질을 인하된 가격으로 - 어려운 예산 상황을 머크와 함께 극복하세요
모든 사진(2)
크기 선택
보기 변경
100 μG
₩824,891
About This Item
UNSPSC 코드:
12352203
NACRES:
NA.41
₩824,891
구입 가능 여부는 고객센터에 문의하십시오.
기존과 동일한 품질을 인하된 가격으로 - 어려운 예산 상황을 머크와 함께 극복하세요
추천 제품
생물학적 소스
mouse
Quality Level
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
2D10, monoclonal
양식
buffered aqueous solution
종 반응성
human
기술
immunofluorescence: suitable
indirect ELISA: suitable
동형
IgG2aκ
GenBank 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... PTPRE(5791)
관련 카테고리
일반 설명
The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. Two alternatively spliced transcript variants of this gene have been reported, one of which encodes a receptor-type PTP that possesses a short extracellular domain, a single transmembrane region, and two tandem intracytoplasmic catalytic domains; Another one encodes a PTP that contains a distinct hydrophilic N-terminus, and thus represents a nonreceptor-type isoform of this PTP. Studies of the similar gene in mice suggested the regulatory roles of this PTP in RAS related signal transduction pathways, cytokines induced SATA signaling, as well as the activation of voltage-gated K+ channels. (provided by RefSeq)
면역원
PTPRE (AAH50062, 511 a.a. ~ 600 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
WRMIWEWKSHTIVMLTEVQEREQDKCYQYWPTEGSVTHGEITIEIKNDTLSEAISIRDFLVTLNQPQARQEEQVRVVRQFHFHGWPEIGI
Sequence
WRMIWEWKSHTIVMLTEVQEREQDKCYQYWPTEGSVTHGEITIEIKNDTLSEAISIRDFLVTLNQPQARQEEQVRVVRQFHFHGWPEIGI
생화학적/생리학적 작용
PTPRE (Protein tyrosine phosphatase, receptor type, E) is associated with various signalling pathways including down regulation of insulin receptor signalling and Janus kinase (Jak)-STAT inhibition signalling pathway. It also plays an important role in the regulation of ERK1/2 pathway by emerging as a phosphatase through its catalytic activity. Study shows that it may play an accessory role in tumour development.
물리적 형태
Solution in phosphate buffered saline, pH 7.4
법적 정보
GenBank is a registered trademark of United States Department of Health and Human Services
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
개인 보호 장비
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
가장 최신 버전 중 하나를 선택하세요:
시험 성적서(COA)
Lot/Batch Number
Assignment of the human protein tyrosine phosphatase epsilon (PTPRE) gene to chromosome 10q26 by fluorescence in situ hybridization.
A M van den Maagdenberg et al.
Genomics, 30(1), 128-129 (1995-11-01)
T Wabakken et al.
Scandinavian journal of immunology, 56(3), 276-285 (2002-08-24)
This report describes the identification and characterization of a novel cytoplasmic isoform of human protein tyrosine phosphatase epsilon (PTPepsilon). The novel isoform, denoted cyt-PTPepsilonPD1, displays only the N-terminal catalytic, active phosphatase domain 1 (PD1) which is common in all known
T Wabakken et al.
Scandinavian journal of immunology, 56(2), 195-203 (2002-07-18)
The expression of protein tyrosine phosphatase epsilon (PTPepsilon) was studied in human tissues and blood cells. High mRNA expression was observed in peripheral blood leucocytes, particularly in monocytes and granulocytes which revealed at least four distinct transcripts. In lymphocytes, PTPepsilon
활성 필터
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.
