WH0005595M1

Anti-MAPK3/ERK1 Antibody

mouse monoclonal, 3C9

• 동의어(들): Anti-ERK1, Anti-P44ERK1, Anti-P44MAPK, Anti-PRKM3, Anti-mitogen-activated protein kinase 3
• MDL number: MFCD02179320
• UNSPSC 코드: 12352203
• NACRES: NA.43

속성

• 제품명: Monoclonal Anti-MAPK3 antibody produced in mouse, clone 3C9, purified immunoglobulin, buffered aqueous solution
• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 3C9, monoclonal
• 양식: buffered aqueous solution
• 종 반응성: human
• 기술: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; immunoprecipitation (IP): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• 동형: IgG2aκ
• GenBank 수납 번호: BC013992
• UniProt 수납 번호: P27361
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... MAPK3(5595)

설명

일반 설명

The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act in a signaling cascade that regulates various cellular processes such as proliferation, differentiation, and cell cycle progression in response to a variety of extracellular signals. This kinase is activated by upstream kinases, resulting in its translocation to the nucleus where it phosphorylates nuclear targets. Alternatively spliced transcript variants encoding different protein isoforms have been described. (provided by RefSeq)

면역원

MAPK3 (AAH13992, 279 a.a. ~ 379 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQPGVLEAP

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)