WH0004591M1
Monoclonal Anti-TRIM37 antibody produced in mouse
clone 2D11, purified immunoglobulin, buffered aqueous solution
동의어(들):
Anti-KIAA0898, Anti-MUL, Anti-POB1, Anti-TEF3, Anti-tripartite motif-containing 37
로그인조직 및 계약 가격 보기
크기 선택
100 μG
₩618,643
₩618,643
예상 입고일2025년 4월 03일세부사항
모든 사진(2)
크기 선택
보기 변경
100 μG
₩618,643
About This Item
UNSPSC 코드:
12352203
NACRES:
NA.41
₩618,643
예상 입고일2025년 4월 03일세부사항
추천 제품
생물학적 소스
mouse
Quality Level
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
2D11, monoclonal
양식
buffered aqueous solution
종 반응성
human
기술
indirect ELISA: suitable
western blot: 1-5 μg/mL
동형
IgG2aκ
GenBank 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... TRIM37(4591)
면역원
TRIM37 (NP_056109, 865 a.a. ~ 964 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GHLEGLQMTDLENNSETGELQPVLPEGASAAPEEGMSSDSDIECDTENEEQEEHTSVGGFHDSFMVMTQPPDEDTHSSFPDGEQIGPEDLSFNTDENSGR
Sequence
GHLEGLQMTDLENNSETGELQPVLPEGASAAPEEGMSSDSDIECDTENEEQEEHTSVGGFHDSFMVMTQPPDEDTHSSFPDGEQIGPEDLSFNTDENSGR
생화학적/생리학적 작용
TRIM37 (Tripartite motif containing 37) restricts centriole reduplication during centriole biogenesis. It participates in epigenetic transcriptional repression by facilitating monoubiquitination of ′Lys-119′ of histone H2A (H2AK119Ub). TRIM37 also possesses anti-HIV activity. Mutation in TRIM37 causes an autosomal recessive prenatal-onset growth disorder, mulibrey nanism with dysmorphic features, cardiomyopathy, and hepatomegaly.
물리적 형태
Solution in phosphate buffered saline, pH 7.4
법적 정보
GenBank is a registered trademark of United States Department of Health and Human Services
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
개인 보호 장비
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
가장 최신 버전 중 하나를 선택하세요:
시험 성적서(COA)
Lot/Batch Number
Azah A Tabah et al.
The Journal of general virology, 95(Pt 4), 960-967 (2013-12-10)
Trim 5α was the first member of the tripartite motif (TRIM) family of proteins that was identified to potently restrict human immunodeficiency virus type 1 (HIV-1) replication. The breadth of antiretroviral activity of TRIM family members is an active area
Fernando R Balestra et al.
Developmental cell, 25(6), 555-571 (2013-06-19)
Centrioles are essential for forming cilia, flagella, and centrosomes and are thus critical for a range of fundamental cellular processes. Despite their importance, the mechanisms governing centriole biogenesis remain incompletely understood. We performed a high-content genome-wide small-interfering-RNA-based screen to identify
Jukka Kallijärvi et al.
Experimental cell research, 308(1), 146-155 (2005-05-12)
Mulibrey nanism is an autosomal recessive prenatal-onset growth disorder characterized by dysmorphic features, cardiomyopathy, and hepatomegaly. Mutations in TRIM37 encoding a tripartite motif (TRIM, RING-B-box-coiled-coil)-family protein underlie mulibrey nanism. We investigated the ubiquitin ligase activity predicted for the RING domain
Sanchita Bhatnagar et al.
Nature, 516(7529), 116-120 (2014-12-04)
The TRIM37 (also known as MUL) gene is located in the 17q23 chromosomal region, which is amplified in up to ∼ 40% of breast cancers. TRIM37 contains a RING finger domain, a hallmark of E3 ubiquitin ligases, but its protein
활성 필터
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.
