WH0002191M1

Monoclonal Anti-FAP antibody produced in mouse

clone 1E5, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-DPPIV, Anti-FAPA, Anti-SEPRASE, Anti-fibroblast activation protein, alpha
• MDL number: MFCD03791521
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 1E5, monoclonal
• 양식: buffered aqueous solution
• 종 반응성: human
• 기술: immunoprecipitation (IP): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG2aκ
• GenBank 수납 번호: BC026250
• UniProt 수납 번호: Q12884
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... FAP(2191)

설명

일반 설명

Fibroblast activation protein (FAP), a cell-surface type II transmembrane glycoprotein serine protease, has a cytoplasmic tail, a single transmembrane domain, and an extracellular domain. It is a member of the S9b family of post-proline cleaving enzymes. FAP is localized in the plasma membrane. FAP gene is mapped to human chromosome 2q24.2. Expression of FAP is hardly seen in adult tissues.

면역원

FAP (AAH26250, 525 a.a. ~ 624 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PPQFDRSKKYPLLIQVYGGPCSQSVRSVFAVNWISYLASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQITAVRKFIEMGFIDEKRIAIWGWS

애플리케이션

Monoclonal Anti-FAP antibody produced in mouse has been used in western blotting.[1]

생화학적/생리학적 작용

Fibroblast activation protein (FAP) participates in the remodeling of tissue, wound healing, inflammation, fibrosis, and tumor development. It possesses dipeptidyl peptidase and endopeptidase activities. FAP plays a key role in the remodeling of extracellular matrix structure and the reconstruction of tumor microarray. Overexpression of the FAP gene might return epithelial ovarian cancer after chemotherapy. FAP gene expression is involved in cancer cells and premalignant metaplastic cells of the esophagus.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)