WH0002119M2
Monoclonal Anti-ETV5 antibody produced in mouse
clone 7C10, purified immunoglobulin, buffered aqueous solution
동의어(들):
Anti-ERM, Anti-ets variant gene 5 (ets-related molecule)
로그인조직 및 계약 가격 보기
크기 선택
100 μG
₩790,787
₩790,787
예상 입고일2025년 6월 16일세부사항
기존과 동일한 품질을 인하된 가격으로 - 어려운 예산 상황을 머크와 함께 극복하세요
모든 사진(6)
크기 선택
보기 변경
100 μG
₩790,787
About This Item
UNSPSC 코드:
12352203
NACRES:
NA.41
₩790,787
예상 입고일2025년 6월 16일세부사항
기존과 동일한 품질을 인하된 가격으로 - 어려운 예산 상황을 머크와 함께 극복하세요
추천 제품
생물학적 소스
mouse
Quality Level
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
7C10, monoclonal
양식
buffered aqueous solution
종 반응성
human, mouse, rat
기술
indirect ELISA: suitable
western blot: 1-5 μg/mL
동형
IgG1κ
GenBank 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... ETV5(2119)
일반 설명
E-twenty-six (Ets) variant gene 5 (ETV5) protein belongs to the polyoma enhancer activator 3 (PEA3) subfamily of ETS transcription factors. The ETV5 gene is located on the human chromosome at 3q27.2.
면역원
ETV5 (NP_004445, 181 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPPPQGFKQEYHDPLYEHGVPGMPGPPAHGFQSPM
Sequence
LPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPPPQGFKQEYHDPLYEHGVPGMPGPPAHGFQSPM
애플리케이션
생화학적/생리학적 작용
E-twenty-six (Ets) variant gene 5 (ETV5) gene is responsible for the survival, proliferation, and self-renewal of spermatogonial stem cells (SSCs). ETV5 protein plays a role in mediating glial cell line-derived neurotrophic factor (GDNF) signaling and induces several genes required for regulating SSC fate. It is involved in limb development and regulates epithelial-mesenchymal transition in several cancer cells. ETV5 protein binds to the conserved GGAA/T motif and regulates gene expression.
물리적 형태
Solution in phosphate buffered saline, pH 7.4
법적 정보
GenBank is a registered trademark of United States Department of Health and Human Services
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
개인 보호 장비
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
가장 최신 버전 중 하나를 선택하세요:
시험 성적서(COA)
Lot/Batch Number
Lee Huang et al.
Cancer research, 81(8), 2071-2085 (2021-02-03)
The failure of once promising target-specific therapeutic strategies often arises from redundancies in gene expression pathways. Even with new melanoma treatments, many patients are not responsive or develop resistance, leading to disease progression in terms of growth and metastasis. We
Erik Melén et al.
The Journal of allergy and clinical immunology, 126(3), 631-637 (2010-09-08)
Epidemiologic studies consistently show associations between asthma and obesity. Shared genetics might account for this association. We sought to identify genetic variants associated with both asthma and obesity. On the basis of a literature search, we identified genes from (1)
Duy Pham et al.
The Journal of allergy and clinical immunology, 134(1), 204-214 (2014-02-04)
The differentiation of TH17 cells, which promote pulmonary inflammation, requires the cooperation of a network of transcription factors. We sought to define the role of Etv5, an Ets-family transcription factor, in TH17 cell development and function. TH17 development was examined
Xin Wu et al.
Biology of reproduction, 85(6), 1114-1123 (2011-08-06)
Insight regarding mechanisms controlling gene expression in the spermatogonial stem cell (SSC) will improve our understanding of the processes regulating spermatogenesis and aid in treating problems associated with male infertility. In the present study, we explored the global gene expression
Severa Bunda et al.
Nature communications, 10(1), 661-661 (2019-02-10)
Capicua (CIC) is a transcriptional repressor that counteracts activation of genes downstream of receptor tyrosine kinase (RTK)/Ras/ERK signaling. It is well-established that tumorigenesis, especially in glioblastoma (GBM), is attributed to hyperactive RTK/Ras/ERK signaling. While CIC is mutated in other tumors
활성 필터
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.
