WH0000475M1

Monoclonal Anti-ATOX1 antibody produced in mouse

clone 2E6, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-ATX1, Anti-ATX1 antioxidant protein 1 homolog (yeast), Anti-HAH1, Anti-MGC138453, Anti-MGC138455
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 2E6, monoclonal
• 양식: buffered aqueous solution
• 종 반응성: human
• 기술: indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• 동형: IgG2aκ
• GenBank 수납 번호: NM_004045
• UniProt 수납 번호: O00244
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... ATOX1(475)

설명

일반 설명

This gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome. (provided by RefSeq)
ATOX1 (antioxidant 1 copper chaperone) is a metallochaperone which is also called as HAH1. It is a small cytosolic protein. ATOX1 is located on human chromosome 5q33.

면역원

ATOX1 (NP_004036, 1 a.a. ~ 68 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE

애플리케이션

Monoclonal Anti-ATOX1 antibody has been used in immunoblot analysis.[1]

생화학적/생리학적 작용

ATOX1 (antioxidant 1 copper chaperone) participates in the human copper modulation system. It plays a major role in the migration of breast cancer cells. ATOX1 helps in the transportation of copper to the cell secretory pathway.

특징 및 장점

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)