콘텐츠로 건너뛰기
Merck
모든 사진(1)

주요 문서

SRP0158

Sigma-Aldrich

Histone H3 (2-58) human

recombinant, expressed in E. coli, ≥70% (SDS-PAGE)

동의어(들):

HIST1H3E, Histone H3.1

로그인조직 및 계약 가격 보기

크기 선택

500 μG
₩849,352

₩849,352


예상 입고일2025년 6월 18일세부사항


벌크 견적 요청

크기 선택

보기 변경
500 μG
₩849,352

About This Item

UNSPSC 코드:
12352200
NACRES:
NA.32

₩849,352


예상 입고일2025년 6월 18일세부사항


벌크 견적 요청

생물학적 소스

human

재조합

expressed in E. coli

분석

≥70% (SDS-PAGE)

양식

aqueous solution

분자량

32 kDa

포장

pkg of 500 μg

저장 조건

avoid repeated freeze/thaw cycles

농도

>0.02 mg/mL

NCBI 수납 번호

UniProt 수납 번호

배송 상태

dry ice

저장 온도

−70°C

유전자 정보

human ... HIST1H3E(8353)

일반 설명

The mammalian chromatin is present in nucleosomes, made of histone octamers (H2A,H2B,H3,H4)2. Mammals contain three main classes of histone H3 variants: the replicative histones (H3.1 and H3.2), the replacement histone (H3.3) and the centromeric histone (Cenp-A).[1][2][3]
Human Histone 3 (GenBank Accession No. NM_003532), (amino acid 2-58) with N-terminal GST tag, MW = 32kDa, expressed in an Escherichia coli expression system.

애플리케이션

Suitable substrate for histone methyltransferases

생화학적/생리학적 작용

Histone proteins are basic building blocks of chromatin.[4] H3.1 (also referred to as HIST1H3E) is mainly expressed in the S phase and is termed as replication-dependent histone.[5] Selective methylation of H3.1 controls replication in heterochromatin area.[6]

물리적 형태

Formulated in 25 mM Tris-HCl, pH 8.0, 100 mM NaCl, 0.05% Tween-20, 20% glycerol and 3 mM DTT.

제조 메모

Thaw on ice. Upon first thaw, briefly spin tube containing enzyme to recover full content of the tube. Aliquot enzyme into single use aliquots. Store remaining undiluted enzyme in aliquots at -70°C. Note: Enzyme is very sensitive to freeze/thaw cycles.

가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Selective methylation of histone H3 variant H3.1 regulates heterochromatin replication.
Jacob Y, et al.
Science, 343, 1249-1249 (2014)
Topography of the histone octamer surface: repeating structural motifs utilized in the docking of nucleosomal DNA.
Arents G and Moudrianakis EN
Proceedings of the National Academy of Sciences of the USA, 90, 10489-10489 (1993)
Genome-wide analysis of histone H3 lysine 4 trimethylation in peripheral blood mononuclear cells of minimal change nephrotic syndrome patients.
Zhang L, et al.
American Journal of Nephrology, 30, 505-505 (2009)
Eric I Campos et al.
Nature structural & molecular biology, 17(11), 1343-1351 (2010-10-19)
The mechanism by which newly synthesized histones are imported into the nucleus and deposited onto replicating chromatin alongside segregating nucleosomal counterparts is poorly understood, yet this program is expected to bear on the putative epigenetic nature of histone post-translational modifications.
Signaling to chromatin through histone modifications.
P Cheung et al.
Cell, 103(2), 263-271 (2000-11-01)

질문

1–2 / 2 질문  
  1. What is the Department of Transportation shipping information for this product?

    1 답변
    1. Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product.

      도움이 되었습니까?

  2. What is the amino acid sequence of Histone H3 (2-58) human, product SRP0158?

    1 답변
    1. The sequence for product SRP0158, Histone H3 (2-58) human, is as follows:ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKS

      도움이 되었습니까?

후기

평점 값 없음

활성 필터

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.