Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product.
추천 제품
생물학적 소스
human
재조합
expressed in E. coli
분석
≥70% (SDS-PAGE)
양식
aqueous solution
분자량
32 kDa
포장
pkg of 500 μg
저장 조건
avoid repeated freeze/thaw cycles
농도
>0.02 mg/mL
NCBI 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−70°C
유전자 정보
human ... HIST1H3E(8353)
일반 설명
Human Histone 3 (GenBank Accession No. NM_003532), (amino acid 2-58) with N-terminal GST tag, MW = 32kDa, expressed in an Escherichia coli expression system.
애플리케이션
생화학적/생리학적 작용
물리적 형태
제조 메모
가장 최신 버전 중 하나를 선택하세요:
시험 성적서(COA)
-
What is the Department of Transportation shipping information for this product?
1 답변-
도움이 되었습니까?
-
-
What is the amino acid sequence of Histone H3 (2-58) human, product SRP0158?
1 답변-
The sequence for product SRP0158, Histone H3 (2-58) human, is as follows:ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKS
도움이 되었습니까?
-
활성 필터
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.