SAB2108957

Anti-CH25H (C-terminal) antibody produced in rabbit HRP conjugated

affinity isolated antibody

• 동의어(들): S28
• UNSPSC 코드: 12352203
• NACRES: NA.45

속성

• 생물학적 소스: rabbit
• 결합: peroxidase conjugate
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 32 kDa
• 종 반응성(상동성에 의해 예측): mouse, bovine, horse, rat, goat, guinea pig, rabbit, zebrafish, human
• 농도: 0.5 mg/mL
• NCBI 수납 번호: NM_003956
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... CH25H(9023)

설명

일반 설명

This is an intronless gene that is involved in cholesterol and lipid metabolism. The encoded protein is a membrane protein and contains clusters of histidine residues essential for catalytic activity. Unlike most other sterol hydroxylases, this enzyme is a member of a small family of enzymes that utilize diiron cofactors to catalyze the hydroxylation of hydrophobic substrates.

면역원

Synthetic peptide directed towards the C-terminal region of Human CH25H

서열

Synthetic peptide located within the following region: VTLLGCHPLTTLTFHVVNIWLSVEDHSGYNFPWSTHRLVPFGWYGGVVHH

물리적 형태

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 12 - Non Combustible Liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable