SAB2108755

Anti-FBXL10

affinity isolated antibody

• 동의어(들): Anti- Fbl10, Anti- JHDM1B, Anti- KDM2B, Anti- PCCX2, Anti-CXXC2
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 152 kDa
• 종 반응성: human, dog, horse, guinea pig, bovine, mouse, rat, rabbit
• 농도: 0.5-1 mg/mL
• 기술: immunoblotting: suitable
• 수납 번호(accession number): NM_032590
• UniProt 수납 번호: Q8NHM5
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... FBXL10(84678)

설명

면역원

Synthetic peptide directed towards the middle region of human FBXL10

생화학적/생리학적 작용

FBXL10 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which fun

서열

Synthetic peptide located within the following region: LSFFKRCGNICHIDLRYCKQVTKEGCEQFIAEMSVSVQFGQVEEKLLQKL

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable