SAB2108707

Anti-RHBDF1

affinity isolated antibody

• 동의어(들): Anti- Dist1, Anti- EGFR-RS, Anti- FLJ2235, Anti- FLJ22357, Anti-C16orf8
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 97 kDa
• 종 반응성: mouse, guinea pig, horse, rat, rabbit, dog, bovine, human
• 농도: 0.5-1 mg/mL
• 기술: immunoblotting: suitable
• 수납 번호(accession number): NM_022450
• UniProt 수납 번호: Q96CC6
• 배송 상태: wet ice
• 저장 온도: −20°C
• 유전자 정보: human ... RHBDF1(64285)

설명

면역원

Synthetic peptide directed towards the N terminal region of human RHBDF1

생화학적/생리학적 작용

RHBDF1 is a seven-transmembrane protein with a long N-terminal cytoplasmic extension that comprises half of the polypeptide sequence, and is found in the endoplasmic reticulum and Golgi, but not on the cell surface. RHBDF1 has a pivotal role in sustaining growth signals in epithelial cancer cells and thus may serve as a therapeutic target for treating epithelial cancers.

서열

Synthetic peptide located within the following region: KDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQPKVR

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 12 - Non Combustible Liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable