₩791,903
예상 입고일2025년 5월 02일세부사항
기존과 동일한 품질을 인하된 가격으로 - 어려운 예산 상황을 머크와 함께 극복하세요
추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
18 kDa
종 반응성
bovine, human, dog, horse, pig, mouse, rat
농도
0.5-1 mg/mL
기술
immunoblotting: suitable
immunohistochemistry: suitable
수납 번호(accession number)
NM_015675
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... GADD45B(4616)
일반 설명
Growth arrest and DNA damage-inducible 45 (GADD45B) gene is located on human chromosome 19p13.3.
면역원
Synthetic peptide directed towards the middle region of human GADD45B
생화학적/생리학적 작용
sGrowth arrest and DNA damage-inducible 45 (GADD45B) acts as a tumor suppressor gene through p53-mediated apoptotic pathways. GADD45B helps to maintain chondrocyte homeostasis by regulating the expression of collagen gene.
서열
Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Abnormal expression of GADD45B in human colorectal carcinoma
Wang, Lis, et al.
Journal of Translational Medicine, 10(1), 215-215 (2012)
Differential expression of GADD45$\beta$ in normal and osteoarthritic cartilage: potential role in homeostasis of articular chondrocytes
Ijiri, Ko, et al.
Arthritis and Rheumatism, 58(7), 2075-2087 (2008)
S Oesterreich et al.
British journal of cancer, 84(4), 493-498 (2001-02-24)
We have recently discovered that the nuclear matrix protein SAFB is an oestrogen receptor corepressor. Since it has become clear that many steroid receptor cofactors play important roles in breast tumorigenesis, we investigated whether SAFB could also be involved in
Liming Yu et al.
Nature communications, 14(1), 4101-4101 (2023-07-26)
Hypercholesterolemia and vascular inflammation are key interconnected contributors to the pathogenesis of atherosclerosis. How hypercholesterolemia initiates vascular inflammation is poorly understood. Here we show in male mice that hypercholesterolemia-driven endothelial activation, monocyte recruitment and atherosclerotic lesion formation are promoted by
활성 필터
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.
