SAB2103331

Anti-MSX2, (N-terminal) antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-CRS2, Anti-FPP, Anti-HOX8, Anti-MSH, Anti-PFM
• MDL number: MFCD01633881
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 29 kDa
• 종 반응성: bovine, horse, dog, human
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunofluorescence: suitable; western blot: suitable
• NCBI 수납 번호: NM_002449
• UniProt 수납 번호: P35548
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... MSX2(4488)

설명

면역원

Synthetic peptide directed towards the n terminal region of human MSX2

생화학적/생리학적 작용

MSX2 probable play a morphogenetic role. MSX2 may play a role in limb-pattern formation. In osteoblasts, MSX2 suppresses transcription driven by the osteocalcin FGF response element (OCFRE).This gene encodes a member of the muscle segment homeobox gene family. The encoded protein is a transcriptional repressor whose normal activity may establish a balance between survival and apoptosis of neural crest-derived cells required for proper craniofacial morphogenesis. The encoded protein may also have a role in promoting cell growth under certain conditions and may be an important target for the RAS signaling pathways. Mutations in this gene are associated with parietal foramina 1 and craniosynostosis type 2. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

서열

Synthetic peptide located within the following region: MASPSKGNDLFSPDEEGPAVVAGPGPGPGGAEGAAEERRVKVSSLPFSVE

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable