ATP6V1C1 (ATPase H+ transporting V1 subunit C1) is a subunit and regulator of V-ATPase (vacuolar ATPase).
면역원
Synthetic peptide directed towards the N terminal region of human ATP6V1C1
생화학적/생리학적 작용
ATP6V1C1 (ATPase H+ transporting V1 subunit C1) is overexpressed in breast cancer, where it modulates the actin structure in a way that it promotes metastasis. This gene is up-regulated in oral squamous cell carcinoma (OSCC).
서열
Synthetic peptide located within the following region: ldafvegvvkkvaqymadvledskdkvqenllangvdlvtyitrfqwdma
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.