추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
57 kDa
종 반응성
human, horse
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... IKZF1(10320)
일반 설명
The Ikaros family zinc finger 1 (IKZF1) gene encodes for the Ikaros transcription factor, and is expressed throughout hematopoiesis. IKZF1 protein is made of an N-terminal DNA-binding domain (DBD) and a C-terminal dimerization domain. The IKZF1 gene is mapped on the human chromosome at 7p12.2.
면역원
Synthetic peptide directed towards the middle region of human IKZF1
생화학적/생리학적 작용
Ikaros positively regulates lymphocyte differentiation and negatively regulates cell proliferation. It plays a role in peripheral lymphocyte homeostasis and negatively regulates follicular B cell activation. Ikaros/IKZF1 is involved in the development of myeloid cells such as red blood cells, platelets, basophils, and neutrophils. Mutations in the IKZF1 gene lead to acute lymphoblastic leukemia (ALL). Downregulation of the IKZF1 gene is observed in the peripheral blood mononuclear cells of systemic lupus erythematosus (SLE) patients. IKZF1 binds and activates the enhancer (delta-A element) of the CD3-delta gene. It functions in the specification and the maturation of the T-lymphocyte. It also interacts with a critical control element in the terminal deoxynucleotidyltransferase (TDT) promoter as well as with the promoters for other genes expressed during early stages of B- and T-cell development.
서열
Synthetic peptide located within the following region: DLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYEK
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our 제품 선택기 도구.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Charles G Mullighan et al.
The New England journal of medicine, 360(5), 470-480 (2009-01-09)
Despite best current therapy, up to 20% of pediatric patients with acute lymphoblastic leukemia (ALL) have a relapse. Recent genomewide analyses have identified a high frequency of DNA copy-number abnormalities in ALL, but the prognostic implications of these abnormalities have
Su-juan Hu et al.
Modern rheumatology, 23(2), 205-209 (2012-07-12)
Ikaros family zinc finger 1, encoded by IKZF1, are lymphoid-restricted zinc finger transcription factors that share common N-terminal Kruppel-like zinc finger DNA-binding domain. IKZF1 play multiple important roles on regulators of lymphocyte differentiation and hematological tumor suppressor. Our genome-wide association
Biclonal and biallelic deletions occur in 20% of B-ALL cases with IKZF1 mutations.
A Dupuis et al.
Leukemia, 27(2), 503-507 (2012-08-08)
Agata Pastorczak et al.
Leukemia research, 35(11), 1534-1536 (2011-09-06)
Recent studies have shown that SNPs mapping to 7p12.2 (IKZF1), 9p21 (CDKN2A), 10q21.2 (ARID5B), and 14q11.2 (CEBPE) and carrier status for recessively inherited Nijmegen Breakage syndrome (NBS) influence childhood acute lymphoblastic leukemia (ALL) risk. To examine these relationship, we analysed
David Boutboul et al.
The Journal of clinical investigation, 128(7), 3071-3087 (2018-06-12)
Ikaros/IKZF1 is an essential transcription factor expressed throughout hematopoiesis. IKZF1 is implicated in lymphocyte and myeloid differentiation and negative regulation of cell proliferation. In humans, somatic mutations in IKZF1 have been linked to the development of B cell acute lymphoblastic
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.