SAB1412695

Monoclonal Anti-ENTPD3 antibody produced in mouse

clone 2A4, purified immunoglobulin

• 동의어(들): Anti-CD39L3, Anti-FLJ93839, Anti-HB6, Anti-NTPDase-3
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 2A4, monoclonal
• 양식: buffered aqueous solution
• 분자량: antigen 37.84 kDa
• 종 반응성: human
• 기술: ELISA: suitable
• 동형: IgG2a
• GenBank 수납 번호: NM_001248
• UniProt 수납 번호: O75355
• 배송 상태: dry ice
• 저장 온도: −20°C
• 유전자 정보: human ... ENTPD3(956)

설명

일반 설명

ENTPD3 is similar to E-type nucleotidases (NTPases). NTPases, such as CD39, mediate catabolism of extracellular nucleotides. ENTPD3 contains 4 apyrase-conserved regions which is characteristic of NTPases. (provided by RefSeq)

면역원

ENTPD3 (NP_001239, 107 a.a. ~ 216 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QDVPRAFEECMQKVKGQVPSHLHGSTPIHLGATAGMRLLRLQNETAANEVLESIQSYFKSQPFDFRGAQIISGQEEGVYGWITANYLMGNFLEKNLWHMWVHPHGVETTG

특징 및 장점

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 11 - Combustible Solids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable