SAB1412513
ANTI-SMAD6 antibody produced in mouse
clone 4F3, purified immunoglobulin, buffered aqueous solution
동의어(들):
HsT17432, MADH6, MADH7, SMAD6
로그인조직 및 계약 가격 보기
크기 선택
100 μG
₩701,162
₩701,162
예상 입고일2025년 6월 11일세부사항
기존과 동일한 품질을 인하된 가격으로 - 어려운 예산 상황을 머크와 함께 극복하세요
모든 사진(2)
크기 선택
보기 변경
100 μG
₩701,162
About This Item
UNSPSC 코드:
12352203
NACRES:
NA.41
₩701,162
예상 입고일2025년 6월 11일세부사항
기존과 동일한 품질을 인하된 가격으로 - 어려운 예산 상황을 머크와 함께 극복하세요
생물학적 소스
mouse
Quality Level
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
4F3, monoclonal
양식
buffered aqueous solution
분자량
antigen 36.74 kDa
종 반응성
human
기술
immunohistochemistry: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL
동형
IgG2bκ
NCBI 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... SMAD6(4091)
일반 설명
SMAD family member 6 (SMAD6) is encoded by the gene mapped to human chromosome 15q22.31. The encoded protein is localized in both nuclei and cytoplasm and is expressed in variety of human tissues, including ovary. SMAD6 consists of MAD homology 2 (MH2) domain involved in protein-protein interaction.
The protein encoded by this gene belongs to the SMAD family of proteins, which are related to Drosophila ‘ mothers against decapentaplegic ′ (Mad) and C. elegans Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions in the negative regulation of BMP and TGF-beta/activin-signalling. Multiple transcript variants encoding different isoforms have been found for this gene.
면역원
SMAD6 (NP_005576, 285 a.a. ~ 384 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RDEYKPLDLSDSTLSYTETEATNSLITAPGEFSDASMSPDATKPSHWCSVAYWEHRTRVGRLYAVYDQAVSIFYDLPQGSGFCLGQLNLEQRSESVRRTR
Sequence
RDEYKPLDLSDSTLSYTETEATNSLITAPGEFSDASMSPDATKPSHWCSVAYWEHRTRVGRLYAVYDQAVSIFYDLPQGSGFCLGQLNLEQRSESVRRTR
생화학적/생리학적 작용
SMAD family member 6 (SMAD6) induces endocytosis and negatively regulates apoptosis by inhibiting transforming growth factor-β (TGF-β) signaling pathway. In addition, it also indirectly regulates stemness by inhibiting erythropoiesis in cord blood hematopoietic stem cells (HSCs). Mutation in the gene leads to congenital cardiovascular malformation (CVM). Elevated expression/genetic variation of SMAD6 is associated with the development of ovarian cancer.
물리적 형태
Solution in phosphate buffered saline, pH 7.4
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
시험 성적서(COA)
Lot/Batch Number
Genetic variants in TGF-? pathway are associated with ovarian cancer risk.
Yin J
PLoS ONE, 6(9), 1-7 (2011)
Statistical genetic analysis of serological measures of common, chronic infections in Alaska Native participants in the GOCADAN study.
Rubicz R
Genetic Epidemiology, 37(7), 751-757 (2013)
Hao Lin et al.
Annals of translational medicine, 9(5), 384-384 (2021-04-13)
Activation of pancreatic stellate cells (PSCs) is a key cause of chronic pancreatitis (CP), while inhibition of transforming growth factor-β (TGF-β) signaling renders PSCs inactive. Inhibitory Smads (I-Smads) impede TGF-β intracellular signaling and may provide a way to alleviate CP.
Nonsynonymous variants in the SMAD6 gene predispose to congenital cardiovascular malformation.
Tan HL
Human Mutation, 33(4), 720-727 (2012)
활성 필터
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.
