SAB1412356

ANTI-PAX7 antibody produced in mouse

clone 1G11, purified immunoglobulin, buffered aqueous solution

• 동의어(들): HUP1, PAX7, PAX7B
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 1G11, monoclonal
• 양식: buffered aqueous solution
• 분자량: antigen 37.84 kDa
• 종 반응성: human
• 기술: indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• 동형: IgG2bκ
• NCBI 수납 번호: NM_002584
• UniProt 수납 번호: P23759
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... PAX7(5081)

설명

일반 설명

Paired box 7 (PAX7) is encoded by the gene mapped to human chromosome 1p36.13. The encoded protein belongs to the PAX family and is expressed in central nervous system (CNS), craniofacial tissue, somites/skeletal muscle. PAX7 protein consists of paired domain (PD), an octapeptide (OP) motif and the helix-turn-helix motif of the homeodomain 1, 2 and 3 (HD1/2/3).

This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box 7 gene is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Three transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

면역원

PAX7 (NP_002575.1, 411 a.a. ~ 520 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTTGYSVDPVAGYQYGQYGQSECLVPWASPVPIPSPTPRASCLFMESYKVVSGWGMSISQMEKLKSSQMEQFT

생화학적/생리학적 작용

Paired box 7 (PAX7) in muscle-derived stem cells, plays an essential role in myogenic satellite cell specification, by inhibiting alternate developmental programs. Variation in the gene expression is associated with melanoma, neuroblastoma, rhabdomyosarcoma. PAX7 and PAX3 is also implicated in skeletal muscle formation and regeneration.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable