SAB1408981

Monoclonal Anti-ERCC2 antibody produced in mouse

clone 2C9, purified immunoglobulin, buffered aqueous solution

• 동의어(들): COFS2, EM9, MGC102762, MGC126218, MGC126219, TTD, XPD
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 2C9, monoclonal
• 양식: buffered aqueous solution
• 분자량: antigen 36.74 kDa
• 종 반응성: human
• 기술: immunofluorescence: suitable; indirect ELISA: suitable
• 동형: IgG2bκ
• NCBI 수납 번호: NM_000400
• UniProt 수납 번호: P18074
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... ERCC2(2068)

설명

일반 설명

The nucleotide excision repair pathway is a mechanism to repair damage to DNA. The protein encoded by this gene is involved in transcription-coupled nucleotide excision repair and is an integral member of the basal transcription factor BTF2/TFIIH complex. The gene product has ATP-dependent DNA helicase activity and belongs to the RAD3/XPD subfamily of helicases. Defects in this gene can result in three different disorders, the cancer-prone syndrome xeroderma pigmentosum complementation group D, trichothiodystrophy, and Cockayne syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

면역원

ERCC2 (NP_000391, 631 a.a. ~ 730 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RILKARLEYLRDQFQIRENDFLTFDAMRHAAQCVGRAIRGKTDYGLMVFADKRFARGDKRGKLPRWIQEHLTDANLNLTVDEGVQVAKYFLRQMAQPFHR

물리적 형태

Solution in phosphate buffered saline, pH 7.4

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable