SAB1405061

Monoclonal Anti-RAX antibody produced in mouse

clone 4F4, purified immunoglobulin, buffered aqueous solution

• 동의어(들): MCOP3, RX
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 4F4, monoclonal
• 양식: buffered aqueous solution
• 분자량: antigen ~37.33 kDa
• 종 반응성: human
• 기술: capture ELISA: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• 동형: IgG2aκ
• NCBI 수납 번호: NM_013435
• UniProt 수납 번호: Q9Y2V3
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... RAX(30062)

설명

일반 설명

Development of the vertebrate eye requires a series of steps including specification of the anterior neural plate, evagination of the optic vesicles from the ventral forebrain, and the cellular differentiation of the lens and retina. Homeobox-containing genes, including RAX, play a critical role in vertebrate and invertebrate eye formation (Mathers et al., 1997 [PubMed 9177348]).[supplied by OMIM

면역원

RAX (NP_038463, 104 a.a. ~ 206 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KEPWEARPSPGLPVGPATGEAKLSEEEQPKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAGKVNLPEVRVQVWFQNRRAKWRRQEKLEVSSMKLQD

물리적 형태

Solution in phosphate buffered saline, pH 7.4

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable