SAB1404671

Monoclonal Anti-USP14, (C-terminal) antibody produced in mouse

clone 1F8, purified immunoglobulin, buffered aqueous solution

• 동의어(들): TGT
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 1F8, monoclonal
• 양식: buffered aqueous solution
• 분자량: antigen ~37.11 kDa
• 종 반응성: mouse, human, rat
• 기술: capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG2aκ
• NCBI 수납 번호: NM_005151
• UniProt 수납 번호: P54578
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... USP14(9097)

설명

일반 설명

This gene encodes a member of the ubiquitin-specific processing (UBP) family of proteases that is a deubiquitinating enzyme (DUB) with His and Cys domains. This protein is located in the cytoplasm and cleaves the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins. Mice with a mutation that results in reduced expression of the ortholog of this protein are retarded for growth, develop severe tremors by 2 to 3 weeks of age followed by hindlimb paralysis and death by 6 to 10 weeks of age. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. (provided by RefSeq)

면역원

USP14 (NP_005142, 395 a.a. ~ 494 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ

물리적 형태

Solution in phosphate buffered saline, pH 7.4

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable