SAB1404585

Monoclonal Anti-CILP antibody produced in mouse

clone 2D10, purified immunoglobulin, buffered aqueous solution

• 동의어(들): CILP-1, HsT18872
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 2D10, monoclonal
• 양식: buffered aqueous solution
• 분자량: antigen ~36.89 kDa
• 종 반응성: human
• 기술: capture ELISA: suitable; indirect ELISA: suitable
• 동형: IgG2aκ
• NCBI 수납 번호: NM_003613
• UniProt 수납 번호: O75339
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... CILP(8483)

설명

일반 설명

Major alterations in the composition of the cartilage extracellular matrix occur in joint disease, such as osteoarthrosis. This gene encodes the cartilage intermediate layer protein (CILP), which increases in early osteoarthrosis cartilage. The encoded protein was thought to encode a protein precursor for 2 different proteins, namely CILP and a homolog of NTPPHase, however later studies identified no nucleotide pyrophosphatase phosphodiesterase (NPP) activity. One isoform of the protein, CILP-1, functions as an IGF-1 antagonist. (provided by RefSeq)

면역원

CILP (NP_003604, 129 a.a. ~ 226 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NCSNYTVRFLCPPGSLRRDTERIWSPWSPWSKCSAACGQTGVQTRTRICLAEMVSLCSEASEEGQHCMGQDCTACDLTCPMGQVNADCDACMCQDFML

물리적 형태

Solution in phosphate buffered saline, pH 7.4

안전성 정보

• Storage Class Code: 13 - Non Combustible Solids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable