₩701,162
예상 입고일2025년 4월 24일세부사항
기존과 동일한 품질을 인하된 가격으로 - 어려운 예산 상황을 머크와 함께 극복하세요
제품명
Monoclonal Anti-SNCB antibody produced in mouse, clone 3G6, purified immunoglobulin, buffered aqueous solution
생물학적 소스
mouse
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
3G6, monoclonal
양식
buffered aqueous solution
분자량
antigen ~40.85 kDa
종 반응성
human
기술
capture ELISA: suitable
immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL
동형
IgG2aκ
NCBI 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... SNCB(6620)
일반 설명
β-Synuclein (SNCB) is present in the presynaptic neuron terminal. It comprises an imperfect KTKEGV sequence at the N-terminus as well as highly acidic and intrinsically disordered regions. SNCB shares sequence similarity with α-synuclein. The SNCB gene is mapped to human chromosome 5q35.2.
면역원
SNCB (AAH02902, 1 a.a. ~ 134 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA
Sequence
MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA
생화학적/생리학적 작용
β-Synuclein (SNCB) may delay the α- synuclein (αS) fibril formation and inhibit its aggregation. SNCB and αS interact with lipid vesicles to form a high degree of α-helical structure. SNCB is implicated in Dementia with Lewy bodies (DLB), a neurodegenerative dementia.
물리적 형태
Solution in phosphate buffered saline, pH 7.4
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
James W P Brown et al.
Scientific reports, 6, 36010-36010 (2016-11-04)
α-Synuclein is an intrinsically disordered protein that is associated with the pathogenesis of Parkinson's disease through the processes involved in the formation of amyloid fibrils. α and β-synuclein are homologous proteins found at comparable levels in presynaptic terminals but β-synuclein
Gina M Moriarty et al.
The Journal of biological chemistry, 292(39), 16368-16379 (2017-07-16)
α-Synuclein (αS) is the primary protein associated with Parkinson's disease, and it undergoes aggregation from its intrinsically disordered monomeric form to a cross-β fibrillar form. The closely related homolog β-synuclein (βS) is essentially fibril-resistant under cytoplasmic physiological conditions. Toxic gain-of-function
Tracey Evans et al.
Brain research, 1681, 1-13 (2017-12-27)
Dementia with Lewy bodies (DLB) is the second most prevalent neurodegenerative dementia, where an accumulation of aggregated fibrillar alpha-synuclein in neurons of limbic and forebrain regions of the brain leads to visual hallucination, cognitive impairment of a fluctuating nature and
Andres Jerez et al.
Journal of clinical oncology : official journal of the American Society of Clinical Oncology, 30(12), 1343-1349 (2012-03-01)
Interstitial deletions of chromosome 5q are common in acute myeloid leukemia (AML) and myelodysplastic syndromes (MDS), pointing toward the pathogenic role of this region in disease phenotype and clonal evolution. The higher level of resolution of single-nucleotide polymorphism array (SNP-A)
활성 필터
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.
