SAB1404343

Monoclonal Anti-RXRG, (N-terminal) antibody produced in mouse

clone 1B2, ascites fluid

• 동의어(들): NR2B3, RXRC
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: ascites fluid
• 항체 생산 유형: primary antibodies
• 클론: 1B2, monoclonal
• 분자량: antigen ~29.63 kDa
• 종 반응성: human
• 기술: indirect ELISA: suitable
• 동형: IgMκ
• NCBI 수납 번호: NM_001009598
• UniProt 수납 번호: P48443
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... RXRG(6258)

설명

일반 설명

This gene encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the antiproliferative effects of retinoic acid (RA). This receptor forms dimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. This gene is expressed at significantly lower levels in non-small cell lung cancer cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. (provided by RefSeq)

면역원

RXRG (-, 1 a.a. ~ 33 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MYGNYSHFMKFPAGYGGCSSPALQLLLSTSLG

물리적 형태

Clear solution

안전성 정보

• Storage Class Code: 11 - Combustible Solids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable