SAB1404157

Monoclonal Anti-OPA1, (C-terminal) antibody produced in mouse

clone 1C10, purified immunoglobulin, buffered aqueous solution

• 동의어(들): FLJ12460, KIAA0567, MGM1, NPG, NTG, largeG
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 1C10, monoclonal
• 양식: buffered aqueous solution
• 분자량: antigen ~38.21 kDa
• 종 반응성: human
• 기술: capture ELISA: suitable; indirect ELISA: suitable
• 동형: IgG1κ
• NCBI 수납 번호: NM_015560
• UniProt 수납 번호: O60313
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... OPA1(4976)

설명

일반 설명

This gene product is a nuclear-encoded mitochondrial protein with similarity to dynamin-related GTPases. It is a component of the mitochondrial network. Mutations in this gene have been associated with optic atrophy type 1, which is a dominantly inherited optic neuropathy resulting in progressive loss of visual acuity, leading in many cases to legal blindness. Multiple transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

면역원

OPA1 (NP_056375, 851 a.a. ~ 960 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NHCNLCRRGFYYYQRHFVDSELECNDVVLFWRIQRMLAITANTLRQQLTNTEVRRLEKNVKEVLEDFAEDGEKKIKLLTGKRVQLAEDLKKVREIQEKLDAFIEALHQEK

물리적 형태

Solution in phosphate buffered saline, pH 7.4

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable