SAB1402964

Monoclonal Anti-ZNF23 antibody produced in mouse

clone 2D3, purified immunoglobulin, buffered aqueous solution

• 동의어(들): KOX16, MGC57283, ZNF359, ZNF612, Zfp612
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 2D3, monoclonal
• 양식: buffered aqueous solution
• 분자량: antigen ~37 kDa
• 종 반응성: human
• 기술: capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG2aκ
• NCBI 수납 번호: NM_145911
• UniProt 수납 번호: P17027
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... ZNF23(7571)

설명

일반 설명

The gene ZNF23 (zinc finger protein 23) is mapped to human chromosome 16q22, a region associated with frequent alterations in acute myeloid leukemia. It belongs to the family of KRAB–ZFPs (Krupple-associated box-containing zinc-finger proteins), a large family of transcription factors. These proteins contain a KRAB domain at the N-terminal. The C-terminal consists of 16 tandem C₂H₂ class zinc fingers. The protein is ubiquitously expressed and the levels are greatly decreased or lost in cases of human cancer. The gene spans a length of 3271 nucleotides that encodes a protein of 643 amino acids.

면역원

ZNF23 (NP_666016.1, 41 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GLQGLQTDIQTDNDLTKEMYEGKENVSFELQRDFSQETDFSEASLLEKQQEVHSAGNIKKEKSNTIDGTVKDETSPVEECFFSQSSNSYQCHTITGEQP

생화학적/생리학적 작용

The gene ZNF23 (zinc finger protein 23) encodes a nuclear protein that is involved in the inhibition of cell cycle progression. Ectopic expression of this protein is associated with increased p27kip-1 expression, growth inhibition and cell cycle arrest in G1 phase. The gene functions as a tumor suppressor, as its down regulation has been associated with carcinogenesis.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable