일반 설명
ATP binding cassette subfamily A member 1 (ABCA1) is encoded by the gene mapped to human chromosome 9q31.1. The encoded protein belongs to the ATP-binding cassette (ABC)1 family of membrane transporters.
The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. With cholesterol as its substrate, this protein functions as a cholesteral efflux pump in the cellular lipid removal pathway. Mutations in this gene have been associated with Tangier′s disease and familial high-density lipoprotein deficiency. (provided by RefSeq)
면역원
ABCA1 (NP_005493, 86 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TPGEAPGVVGNFNKSIVARLFSDARRLLLYSQKDTSMKDMRKVLRTLQQIKKSSSNLKLQDFLVDNETFSGFLYHNLSLPKSTVDKMLRADVILHKVFLQ
Sequence
TPGEAPGVVGNFNKSIVARLFSDARRLLLYSQKDTSMKDMRKVLRTLQQIKKSSSNLKLQDFLVDNETFSGFLYHNLSLPKSTVDKMLRADVILHKVFLQ
애플리케이션
Monoclonal Anti-ABCA1 antibody produced in mouse has been used in confocal laser scanning microscopy and Western blot technique.
생화학적/생리학적 작용
ATP binding cassette subfamily A member 1 (ABCA1) functions as a phospholipid and/or cholesterol transporter. ABCA1 interacts with its ligand apolipoprotein to regulate cholesterol trafficking. Mutation in the gene is associated with the development of Tangier disease and familial hypoalipoproteinemia.
물리적 형태
Clear solution
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
11 - Combustible Solids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Transcriptional Profiling Identifies Two Members of the ATP-binding Cassette Transporter Superfamily Required for Sterol Uptake in Yeast
Wilcox L J, et al.
The Journal of Biological Chemistry, 277(36), 32466-32472 (2002)
Imbalanced response of ATP-binding cassette transporter A1 and CD36 expression to increased oxidized low-density lipoprotein loading contributes to the development of THP-1 derived foam cells
Liu H Y, et al.
Journal of Biochemistry, 155(1), 35-42 (2014)
Hong-Yan Liu et al.
Journal of biochemistry, 155(1), 35-42 (2014-01-08)
ATP-binding cassette transporter A1 (ABCA1) and CD36, type B scavenger receptor, function as the key mediators of macrophages cholesterol efflux and intake, respectively. However, their contribution to development of foam cells still remains uncertain. We here examined the effects of
Identification and functional analysis of a naturally occurring E89K mutation in the ABCA1 gene of the WHAM chicken.
Attie A D, et al.
Journal of Lipid Research, 43(10), 1610-1617 (2002)
ABCA1 Is the cAMP-inducible Apolipoprotein Receptor That Mediates Cholesterol Secretion from Macrophages
Oram J F, et al.
The Journal of Biological Chemistry, 275(44), 34508-34511 (2000)
활성 필터
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.
